PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS913423 to PF09922 (DUF2154)

VIMSS913423 has 233 amino acids

Query:       DUF2154  [M=114]
Accession:   PF09922.9
Description: Cell wall-active antibiotics response 4TMS YvqF
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
      7e-35  105.6   2.3    9.5e-35  105.2   2.3    1.2  1  VIMSS913423  


Domain annotation for each sequence (and alignments):
>> VIMSS913423  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  105.2   2.3   9.5e-35   9.5e-35       1     114 []     119     230 ..     119     230 .. 0.98

  Alignments for each domain:
  == domain 1  score: 105.2 bits;  conditional E-value: 9.5e-35
      DUF2154   1 liGdqklgkepyeledinissiiGdttiDLtkavlpegetvivirkliGdvkilVPedvevsveasvifGdvkvldekeagllneslkleseeyeeae 98 
                  ++G+q+++  +y++ed++i+++iGd++iDLtka+  +++++iv+r+++G+v++++P ++++++++++++G++ v +ek++++ n+++++e+   +++ 
  VIMSS913423 119 WFGEQRTPVYVYKWEDVQIQHGIGDLHIDLTKAANIKENNTIVVRHILGKVQVILPVNYNINLHVAAFYGSTYV-NEKSYKVENNNIHIEEMMKPDN- 214
                  9**********************************************************************995.8999999**********99988. PP

      DUF2154  99 kkvkiivslliGdveV 114
                  ++v+i+vs++iGdveV
  VIMSS913423 215 YTVNIYVSTFIGDVEV 230
                  ***************9 PP



Or compare VIMSS913423 to CDD or PaperBLAST