WP_002278087.1 has 228 amino acids
Query: LiaF-like_C [M=114]
Accession: PF09922.13
Description: Cell wall-active antibiotics response LiaF, C-terminal
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
5.6e-12 31.9 0.1 8.4e-12 31.3 0.1 1.4 1 WP_002278087.1
Domain annotation for each sequence (and alignments):
>> WP_002278087.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 31.3 0.1 8.4e-12 8.4e-12 3 79 .. 129 205 .. 127 225 .. 0.89
Alignments for each domain:
== domain 1 score: 31.3 bits; conditional E-value: 8.4e-12
LiaF-like_C 3 GdqklgkepyelediniqrviGdttiDLskavlpkgetvivirkliGdvkilVPedvevsveasvifGsvtvldeke 79
++ + ++ el++i i++ +G+ +DLs+a + i i +G++++ +P+++++ ++ + f s+++ d +
WP_002278087.1 129 SENTSYVTSQELNKIIIDTKFGEQSVDLSQAQFMTDSPEIHIDVSFGETNLRIPNNWKIINKTHSPFASISFSDFPS 205
56666778999***********************************************************9987655 PP
Or compare WP_002278087.1 to CDD or PaperBLAST