PaperBLAST – Find papers about a protein or its homologs

 

Align WP_004301517.1 to PF09922 (DUF2154)

WP_004301517.1 has 264 amino acids

Query:       DUF2154  [M=114]
Accession:   PF09922.9
Description: Cell wall-active antibiotics response 4TMS YvqF
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    2.1e-15   42.9   0.0    3.9e-15   42.0   0.0    1.5  1  WP_004301517.1  


Domain annotation for each sequence (and alignments):
>> WP_004301517.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   42.0   0.0   3.9e-15   3.9e-15      15      84 ..     176     244 ..     164     253 .. 0.87

  Alignments for each domain:
  == domain 1  score: 42.0 bits;  conditional E-value: 3.9e-15
         DUF2154  15 edinissiiGdttiDLtkavlpegetvivirkliGdvkilVPedvevsveasvifGdvkvldekeaglln 84 
                     ++  i + +G ttiDL+++ ++ get i +    G v+i+VP+d++v  + +++fG  + ++ ++++ +n
  WP_004301517.1 176 KGAMIRTSFGGTTIDLRHTHIAPGETYIDLDCSWGGVEIYVPSDWTVVFKCNAFFGGCDDKRWQNGN-VN 244
                     66778999************************************************99955555555.44 PP



Or compare WP_004301517.1 to CDD or PaperBLAST