PaperBLAST – Find papers about a protein or its homologs

 

Align WP_022470709.1 to PF09922 (DUF2154)

WP_022470709.1 has 264 amino acids

Query:       DUF2154  [M=114]
Accession:   PF09922.9
Description: Cell wall-active antibiotics response 4TMS YvqF
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    9.6e-15   40.8   0.0    1.5e-14   40.1   0.0    1.3  1  WP_022470709.1  


Domain annotation for each sequence (and alignments):
>> WP_022470709.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   40.1   0.0   1.5e-14   1.5e-14      15      85 ..     176     245 ..     162     251 .. 0.84

  Alignments for each domain:
  == domain 1  score: 40.1 bits;  conditional E-value: 1.5e-14
         DUF2154  15 edinissiiGdttiDLtkavlpegetvivirkliGdvkilVPedvevsveasvifGdvkvldekeagllne 85 
                     ++  + +  G ttiDL+++ ++ get i +    G ++i+VP+d++v  + +++fG  + ++ ++++ +n+
  WP_022470709.1 176 KGAVVRTSCGGTTIDLRHTHIAPGETYIDLDCSWGGIEIYVPSDWKVVFKCNAFFGGCDDKRWQNGN-INK 245
                     556677889************************************************9955555555.554 PP



Or compare WP_022470709.1 to CDD or PaperBLAST