WP_060618714.1 has 418 amino acids
Query: APP1_cat [M=155] Accession: PF09949.13 Description: Phosphatidate phosphatase APP1, catalytic domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-52 163.5 0.0 2.8e-52 162.9 0.0 1.3 1 WP_060618714.1 Domain annotation for each sequence (and alignments): >> WP_060618714.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 162.9 0.0 2.8e-52 2.8e-52 1 155 [] 217 368 .. 217 368 .. 0.98 Alignments for each domain: == domain 1 score: 162.9 bits; conditional E-value: 2.8e-52 APP1_cat 1 vgviSDiDDtikvtgvlsplrallntlfvneekrlpvpgmaelYkalakseeeapvfYvSnspwnlyplleefleenklPkgslllrdlsltkks 95 vg+iSD+DDti++t+++ ++a++n lf+n++k+ vpgm+ l++++a+ ++ap+fY+S+spwn+ + +++f++ +++P+g+lllrdl+++ k+ WP_060618714.1 217 VGIISDVDDTIMITQAPVLWKAAYNLLFLNPKKKASVPGMSVLFTRIADLFPGAPFFYLSTSPWNVESSIRNFITDHGFPEGPLLLRDLDPRPKT 311 68***********************************************999***************************************9999 PP APP1_cat 96 llksllesaerKreeiekiledfpkrkfiliGDsgekDpeiYaeiakefpgrvkailiRk 155 ++ s+ ++K e e++++dfp++kfil+GD+g+kDp +Ya+ia+++pgrv+ai+iR+ WP_060618714.1 312 FVPSG---PQHKLEFAEQLMADFPDMKFILVGDDGQKDPTTYATIAHRYPGRVLAIAIRQ 368 99999...8**************************************************7 PP
Or compare WP_060618714.1 to CDD or PaperBLAST