SwissProt::Q3L8N0 has 407 amino acids
Query: MPAB_Lcp_cat [M=230] Accession: PF09995.13 Description: ER-bound oxygenase mpaB/B'/Rubber oxygenase, catalytic domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-19 56.0 2.0 3.2e-19 56.0 2.0 1.9 2 SwissProt::Q3L8N0 Domain annotation for each sequence (and alignments): >> SwissProt::Q3L8N0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.7 0.3 0.14 0.14 193 213 .. 85 108 .. 21 124 .. 0.51 2 ! 56.0 2.0 3.2e-19 3.2e-19 11 221 .. 133 351 .. 127 361 .. 0.83 Alignments for each domain: == domain 1 score: -1.7 bits; conditional E-value: 0.14 MPAB_Lcp_cat 193 lraltvgllpprlrellglp...w 213 + ++ g lp lre + + SwissProt::Q3L8N0 85 NDQALPGGLPGDLREFMEHArrmP 108 223444444444444444334443 PP == domain 2 score: 56.0 bits; conditional E-value: 3.2e-19 MPAB_Lcp_cat 11 llgglralllqalhplvgaGvadhsrfadplgRlrrTltyvatvtygt....geeaealaerVrrlHarvrgtd........dsgrrygald 90 l gl +l+ ++ p+ ++v + ad+ +R++ T++ + + + + +a++ r +Ha+vr+ +sg + +++ SwissProt::Q3L8N0 133 LY-GLGSGLMSTAIPRESRAVYYSKGGADMKDRIAKTARLGYDIGDLDaylpHGSMIVTAVKTRMVHAAVRHLLpqspawsqTSGGQKIPIS 223 44.478888889********995556699**********9999876446666666999*************885533334444556777*** PP MPAB_Lcp_cat 91 pelllwvhatlvdsfldayerfvgpltdaeaeryyaewrrvgrllgvpprdvpatraefeaywdamlrpelevtpearellddlrklpaplr 182 +++ + ++ l +++ ++ ++ +++ a+ae+y++ w + +++lgv+++ +pat++++ a ++l+p l+ tpe +l++ l + a l SwissProt::Q3L8N0 224 QADIMVTWHSLATFVMRKMKQWGVRVNTADAEAYLHVWQVSAHMLGVSDEYIPATWDAANAQSKQVLDPILAHTPEGEALTEVLLGIVAELD 315 **********************888*******************************************************666644444444 PP MPAB_Lcp_cat 183 illarplgrllraltvgllpprlrellglpwtarderrl 221 a + ++l+ a+++ +l+ ++ ++ gl ++ er SwissProt::Q3L8N0 316 ---AGLTRPLIGAFSRYTLGGEVGDMIGLAKQPVLERLI 351 ...7789**********************9655555543 PP
Or compare SwissProt::Q3L8N0 to CDD or PaperBLAST