VIMSS246944 has 401 amino acids
Query: MPAB_Lcp_cat [M=230] Accession: PF09995.13 Description: ER-bound oxygenase mpaB/B'/Rubber oxygenase, catalytic domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-18 54.1 3.6 1.9e-18 53.4 3.6 1.3 1 VIMSS246944 Domain annotation for each sequence (and alignments): >> VIMSS246944 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 53.4 3.6 1.9e-18 1.9e-18 10 223 .. 124 346 .. 118 353 .. 0.81 Alignments for each domain: == domain 1 score: 53.4 bits; conditional E-value: 1.9e-18 MPAB_Lcp_cat 10 lll.gglralllqalhplvgaGvadhsrfadplgRlrrTltyvatvty....gtgeeaealaerVrrlHarvrgtd......dsgrryg.aldpell 94 l++ gl +++ ++ p+ ++ v + ad+ +R++ T+t+ + + + + +a + r++Ha+vr+ +sg+ + +++ ++ VIMSS246944 124 LFMlYGLGSGIMSTVIPREARSVYWSAGGADMQDRAAKTFTFGYDLSQlkafEPTGQFVVTANKTRLVHAAVRHLLprsphwTSGADQDiPISAADI 220 4444668899998999999999995555599**************99855554477799**************986644446566888888888888 PP MPAB_Lcp_cat 95 lwvhatlvdsfldayerfvgpltdaeaeryyaewrrvgrllgvpprdvpatraefeaywdamlrpelevtpearellddlrklpaplrillarplgr 191 l + l + + + p+++a++e++++ w ++ +llgvp++ +p+t+a++ea +++l+p l++t e +l+++l l+a++ + + ++ VIMSS246944 221 LVTFHSLGTYVRSKLIEWKVPFPAADQEAFLHSWQVALHLLGVPDEYIPKTWAAAEAQSAQVLTPILAPTTEGIKLAEELLGLTAQID---LGVTRG 314 888877776666555555667*************************99****************************999955554444...468899 PP MPAB_Lcp_cat 192 llraltvgllpprlrellglpwtarderrlrr 223 +l +++ +l +++ + lgl+ ++ ++ +r VIMSS246944 315 FLNEFVRYVLSDEVGDWLGLRRDPVAAALVRT 346 ********************966655555544 PP
Or compare VIMSS246944 to CDD or PaperBLAST