PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS246944 to PF09995 (DUF2236)

VIMSS246944 has 401 amino acids

Query:       DUF2236  [M=227]
Accession:   PF09995.9
Description: Uncharacterized protein conserved in bacteria (DUF2236)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    5.5e-22   65.2   2.7      1e-21   64.3   2.7    1.3  1  VIMSS246944  


Domain annotation for each sequence (and alignments):
>> VIMSS246944  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   64.3   2.7     1e-21     1e-21       9     215 ..     125     345 ..     118     354 .. 0.80

  Alignments for each domain:
  == domain 1  score: 64.3 bits;  conditional E-value: 1e-21
      DUF2236   9 illlgalaalllqaahplvltgvldhstf.adplrRllrTaqfiltvvy....gsgeeaeaaaarVrllHaavrgtd......asgeryg.ainpedl 94 
                  ++l  +l  +++ ++ p+ ++ v   s   ad+++R   T++f +++ +     ++++   +a + rl+Haavr          sg+  + +i   d 
  VIMSS246944 125 FML-YGLGSGIMSTVIPREARSVY-WSAGgADMQDRAAKTFTFGYDLSQlkafEPTGQFVVTANKTRLVHAAVRHLLprsphwTSGADQDiPISAADI 220
                  444.55777777788888888777.3434488****************98888558889***************876887788778************ PP

      DUF2236  95 lwvhatfsasfl.raygrtvgpltaeeeeayyhewrrvgrllGvpdrllpatraafdayldemvlaelevdeearel....gdarll.....parpal 182
                  l +   +++ +  ++++ +  p++a+++ea++h w ++ +llGvpd+ +p+t+aa++a  ++++ + l+++ e  +l                + + +
  VIMSS246944 221 LVTFHSLGTYVRsKLIE-WKVPFPAADQEAFLHSWQVALHLLGVPDEYIPKTWAAAEAQSAQVLTPILAPTTEGIKLaeelL----GltaqiDLGVTR 313
                  *9999988888845555.5577**********************************************99999999943330....245555677888 PP

      DUF2236 183 pllrvitrgllppalrellglpvpwssrdellv 215
                   +l   +r++l +++ + lgl++++  + +l++
  VIMSS246944 314 GFLNEFVRYVLSDEVGDWLGLRRDPV-AAALVR 345
                  99999999999999999999997633.333332 PP



Or compare VIMSS246944 to CDD or PaperBLAST