VIMSS32598 has 351 amino acids
Query: MPAB_Lcp_cat [M=230] Accession: PF09995.13 Description: ER-bound oxygenase mpaB/B'/Rubber oxygenase, catalytic domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-79 253.4 13.4 2e-79 252.9 13.4 1.2 1 VIMSS32598 Domain annotation for each sequence (and alignments): >> VIMSS32598 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 252.9 13.4 2e-79 2e-79 1 229 [. 59 294 .. 59 295 .. 0.98 Alignments for each domain: == domain 1 score: 252.9 bits; conditional E-value: 2e-79 MPAB_Lcp_cat 1 wrvhgderilllgglralllqalhplvgaGvadhsrfad.plgRlrrTltyvatvtygtgeeaealaerVrrlHarvrgtddsgrrygaldpelllw 96 wr++gd+r +l g ++a+ +q++hp++ga+v+dhs+f++ + Rl r+l+++ +v+++ g++a ++++Vr++H ++g+d +grry+al+p++++w VIMSS32598 59 WRYFGDWRGMLQG-PWAGSMQNMHPQLGAAVEDHSTFFReRWPRLLRSLYPIGGVVFD-GDRAPVTGVQVRDYHITIKGVDGAGRRYHALNPDVFYW 153 ***********99.***********************777******************.999*******************99************** PP MPAB_Lcp_cat 97 vhatlvdsfldayerfvgpltdaeaeryyaewrrvgrllgvpprdvpatraefeaywdamlrpelevtpearellddl........rklpaplrill 185 +hat++ ++l+++erf+g lt+a+++++++e+++++r++g+++r+vpat++ef++ywd+m+r+ le + +ar++ld +++p++l+ + VIMSS32598 154 AHATFFVGTLHVAERFCGGLTEAQRRQLFDEHVQWYRMYGMSMRPVPATWEEFQDYWDHMCRNVLENNFAARAVLDLTelpkppfaQRVPDWLWAAP 250 **************************************************************************8888******************* PP MPAB_Lcp_cat 186 arplgrllraltvgllpprlrellglpwtarderrlrrlarlvr 229 +++l+r++ +ltvgl++p +rel+g++w +rde+ +rr++ +vr VIMSS32598 251 RKLLARFFVWLTVGLYDPPVRELMGYRWLRRDEWLHRRFGDIVR 294 ***************************************99998 PP
Or compare VIMSS32598 to CDD or PaperBLAST