PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS61182 to PF09995 (DUF2236)

VIMSS61182 has 293 amino acids

Query:       DUF2236  [M=227]
Accession:   PF09995.9
Description: Uncharacterized protein conserved in bacteria (DUF2236)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    7.3e-62  195.6   5.7      1e-61  195.2   5.7    1.2  1  VIMSS61182  


Domain annotation for each sequence (and alignments):
>> VIMSS61182  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  195.2   5.7     1e-61     1e-61       1     227 []      42     272 ..      42     290 .. 0.94

  Alignments for each domain:
  == domain 1  score: 195.2 bits;  conditional E-value: 1e-61
     DUF2236   1 wryagdelilllgalaalllqaahplvltgvldhstf.adplrRllrTaqfiltvvygsgeeaeaaaarVrllHaavrgtdasgerygainpedllwvh 98 
                 w+++gd  ++++g++ alllq++hpl+l+gv+dhs+f +d+l+Rl+rT+qfi +++yg+ ++ae++++rVr++H +v g+ ++g++y+a +p++l+wvh
  VIMSS61182  42 WKVHGDFSSMMIGGIGALLLQMLHPLALAGVWDHSNFrDDLLGRLRRTGQFISATTYGPLADAERLIERVRRIHESVIGQLPDGTPYSASDPDLLTWVH 140
                 9************************************777*********************************************************** PP

     DUF2236  99 atfsasflraygrt.vgpltaeeeeayyhewrrvgrllGvpdrllpatraafdayldemvlaelevdeearelgdarll........parpalpllrvi 188
                 ++++ sfl+ y r+ ++ l+  e+++yy e ++v++ lG  +r++p++r++ +ayl++m +++l+ de++re+  +r+l        +arp+++l+  +
  VIMSS61182 141 VAEVSSFLKSYLRYlNPDLPGSEQDRYYSEIALVAERLG--ARAVPRDRQQIAAYLEAM-RPRLRCDERTREV--VRILfnapapstLARPFGALMLRA 234
                 **************8888*********************..799***************.9************..666667999999************ PP

     DUF2236 189 trgllppalrellglpvpwssrdellvvalralvrlara 227
                  ++llp+++  +l lp  ++ +++l + ++r+ v l+r+
  VIMSS61182 235 GAELLPEWAGSMLDLPF-SPLQRRLIRGSVRRSVPLLRW 272
                 ****************6.455566666888888888776 PP



Or compare VIMSS61182 to CDD or PaperBLAST