WP_083036515.1 has 284 amino acids
Query: MPAB_Lcp_cat [M=230] Accession: PF09995.13 Description: ER-bound oxygenase mpaB/B'/Rubber oxygenase, catalytic domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3e-76 242.6 2.1 4.3e-76 242.0 2.1 1.2 1 WP_083036515.1 Domain annotation for each sequence (and alignments): >> WP_083036515.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 242.0 2.1 4.3e-76 4.3e-76 4 228 .. 20 241 .. 17 242 .. 0.95 Alignments for each domain: == domain 1 score: 242.0 bits; conditional E-value: 4.3e-76 MPAB_Lcp_cat 4 hgderilllgglralllqalhplvgaGvadhsrf.adplgRlrrTltyvatvtygtgeeaealaerVrrlHarvrgtddsgrrygaldpelllwv 97 +g+ ++l+lg+++ +llq+++p+vg+Gvadhs++ ++pl+Rlr+T+ty++++t+gt+ee++a+a +V+++H +v++++d ++ y+ +dp+l+lwv WP_083036515.1 20 VGE-GFLFLGAGVTVLLQLAEPGVGHGVADHSTVlSRPLDRLRTTMTYIYVTTLGTEEERRAVAKMVNQAHVPVKSKPDGPVVYNGFDPDLQLWV 113 555.99***************************9677*****************************************988************** PP MPAB_Lcp_cat 98 hatlvdsfldayerfvgpltdaeaeryyaewrrvgrllgvpprdvpatraefeaywdamlrpelevtpearellddl.rklpaplrillarplgr 191 +atl++ d+yerf gp++da+aer+y+++ + g++l+v+p+++p traefe+yw++ l +el++++++r+++++l r pl+ r+ ++ WP_083036515.1 114 AATLYKNGQDLYERFLGPMDDATAERLYQQSGVYGTTLQVKPEMWPPTRAEFEQYWQRKL-DELTIDDHVRAFCHELfRGGDSPLL---IRLGMP 204 ***********************************************************7.****************955555566...58**** PP MPAB_Lcp_cat 192 llraltvgllpprlrellglpwtarderrlrrlarlv 228 l+r++t+gllpp+lre+l++ w++rd+ +++l++++ WP_083036515.1 205 LNRWITRGLLPPQLREQLHWSWSPRDQQLFDALMAVL 241 **********************************986 PP
Or compare WP_083036515.1 to CDD or PaperBLAST