PaperBLAST – Find papers about a protein or its homologs

 

Align NP_083837.2 to PF10176 (DUF2370)

NP_083837.2 has 338 amino acids

Query:       DUF2370  [M=226]
Accession:   PF10176.9
Description: Protein of unknown function (DUF2370)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    3.2e-13   35.9   8.0    2.4e-10   26.5   0.0    3.2  3  NP_083837.2  


Domain annotation for each sequence (and alignments):
>> NP_083837.2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.6   2.7      0.01      0.01      37      74 ..     131     174 ..      90     180 .. 0.78
   2 !   26.5   0.0   2.4e-10   2.4e-10      38     128 ..     184     282 ..     176     291 .. 0.89
   3 !    9.5   0.2   3.9e-05   3.9e-05     188     223 ..     294     329 ..     284     332 .. 0.89

  Alignments for each domain:
  == domain 1  score: 1.6 bits;  conditional E-value: 0.01
      DUF2370  37 ekpPtYeeAaa......DaaPpYwettvlapslesdevlvdGlp 74 
                   + Pt e+Aa       D+ PpY  +tv ap++++ +v+ +  p
  NP_083837.2 131 LAAPTVEAAASapaldpDSPPPYSSITVEAPTTSDTDVYSEFYP 174
                  45677777764444445999**************9999977655 PP

  == domain 2  score: 26.5 bits;  conditional E-value: 2.4e-10
      DUF2370  38 kpPtYeeAaaDaaPpYwettvlapsles.......devl.vdGlpvGnlfsfvwNllvsvsFqlvGFlltYlLHtthAakqGSraGLGitliqygfsl 127
                  + PtY+eA +  a         ap+ ++       d+   v+ l vGn   f+    +++ F  +GF l++ +  t A + G+  G G+ li++ + +
  NP_083837.2 184 SLPTYDEAEKAKAAALAAAAADAPQRNQeedctprDDFSdVEQLRVGNDGIFMLAFFMAFIFNWLGFCLSFCITNTIAGRYGAICGFGLSLIKWILIV 281
                  67999999999999999999999998888888998665449***************************************************987665 PP

      DUF2370 128 r 128
                  r
  NP_083837.2 282 R 282
                  5 PP

  == domain 3  score: 9.5 bits;  conditional E-value: 3.9e-05
      DUF2370 188 sewlayvlmilGlfiliksvvdylrvkrlekkvlas 223
                  + wl +++ +lGl++  +++v+yl+v+ + +++ a+
  NP_083837.2 294 QYWLWWIFLVLGLLLFFRGFVNYLKVRNMSESMAAA 329
                  569999***********************9998766 PP



Or compare NP_083837.2 to CDD or PaperBLAST