PaperBLAST – Find papers about a protein or its homologs

 

Align NP_085048.1 to PF10176 (DUF2370)

NP_085048.1 has 221 amino acids

Query:       DUF2370  [M=226]
Accession:   PF10176.9
Description: Protein of unknown function (DUF2370)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
      6e-15   41.6   6.8    8.5e-12   31.3   0.0    3.0  3  NP_085048.1  


Domain annotation for each sequence (and alignments):
>> NP_085048.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !    2.9   1.0    0.0041    0.0041      33      62 ..      22      51 ..       7      59 .. 0.73
   2 !   31.3   0.0   8.5e-12   8.5e-12      38     127 ..      63     164 ..      54     173 .. 0.86
   3 !   10.1   0.1   2.6e-05   2.6e-05     188     220 ..     177     209 ..     162     215 .. 0.89

  Alignments for each domain:
  == domain 1  score: 2.9 bits;  conditional E-value: 0.0041
      DUF2370 33 eekeekpPtYeeAaaDaaPpYwettvlaps 62
                  ++ee+    e+Aa Da PpY  ++  +++
  NP_085048.1 22 LQNEEESGEPEQAAGDAPPPYSSISAESAA 51
                 456666667799999999999887776655 PP

  == domain 2  score: 31.3 bits;  conditional E-value: 8.5e-12
      DUF2370  38 kpPtYeeAaaDaaPpYwettvlapsles.............dev.lvdGlpvGnlfsfvwNllvsvsFqlvGFlltYlLHtthAakqGSraGLGitli 121
                  kpP+Y+ A+  + P+Y e + + ++++              d+    d l +Gn   f+    +++ F  +GF+l++ L t+ A + G+  G G+ li
  NP_085048.1  63 KPPSYNVAT--TLPSYDEAERTKAEATIplvpgrdedfvgrDDFdDADQLRIGNDGIFMLTFFMAFLFNWIGFFLSFCLTTSAAGRYGAISGFGLSLI 158
                  799999886..68999999988888887899999888888844323699************************************************* PP

      DUF2370 122 qygfsl 127
                  ++ + +
  NP_085048.1 159 KWILIV 164
                  986655 PP

  == domain 3  score: 10.1 bits;  conditional E-value: 2.6e-05
      DUF2370 188 sewlayvlmilGlfiliksvvdylrvkrlekkv 220
                  + wl +v+ +lG+++ ++++++y +v+++ +++
  NP_085048.1 177 QYWLWWVFLVLGFLLFLRGFINYAKVRKMPETF 209
                  569999**********************98776 PP



Or compare NP_085048.1 to CDD or PaperBLAST