PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q5U2S1 to PF10176 (DUF2370)

SwissProt::Q5U2S1 has 221 amino acids

Query:       DUF2370  [M=226]
Accession:   PF10176.9
Description: Protein of unknown function (DUF2370)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    3.1e-15   42.5   6.5      8e-12   31.4   0.1    3.1  3  SwissProt::Q5U2S1  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q5U2S1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !    3.7   0.9    0.0023    0.0023      32      62 ..      21      51 ..       7      62 .. 0.78
   2 !   31.4   0.1     8e-12     8e-12      38     127 ..      63     164 ..      50     172 .. 0.86
   3 !   10.0   0.1   2.7e-05   2.7e-05     188     220 ..     177     209 ..     165     215 .. 0.89

  Alignments for each domain:
  == domain 1  score: 3.7 bits;  conditional E-value: 0.0023
            DUF2370 32 eeekeekpPtYeeAaaDaaPpYwettvlaps 62
                       + ++ee+p   e+ a Da PpY  ++  +++
  SwissProt::Q5U2S1 21 QLQNEEEPGEREQTAGDAPPPYSSISAESAA 51
                       4568899999999999999999887776655 PP

  == domain 2  score: 31.4 bits;  conditional E-value: 8e-12
            DUF2370  38 kpPtYeeAaaDaaPpYwettvlapsles.............dev.lvdGlpvGnlfsfvwNllvsvsFqlvGFlltYlLHtthAakqGSraG 115
                        kpP+Y+ A+  + P+Y e + + ++++              d+    d l +Gn   f+    +++ F  +GF+l++ L t+ A + G+  G
  SwissProt::Q5U2S1  63 KPPSYNVAT--TLPSYDEAERTKAEATIplvpgrdedfvgrDDFdDADQLRIGNDGIFMLTFFMAFLFNWIGFFLSFCLTTSAAGRYGAISG 152
                        899999886..68999999988888887899999888888844323699******************************************* PP

            DUF2370 116 LGitliqygfsl 127
                         G+ li++ + +
  SwissProt::Q5U2S1 153 FGLSLIKWILIV 164
                        ******986655 PP

  == domain 3  score: 10.0 bits;  conditional E-value: 2.7e-05
            DUF2370 188 sewlayvlmilGlfiliksvvdylrvkrlekkv 220
                        + wl +v+ +lG+++ ++++++y +v+++ +++
  SwissProt::Q5U2S1 177 QYWLWWVFLVLGFLLFLRGFINYAKVRKMPETF 209
                        569999**********************98776 PP



Or compare SwissProt::Q5U2S1 to CDD or PaperBLAST