PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q91ZP6 to PF10176 (DUF2370)

SwissProt::Q91ZP6 has 311 amino acids

Query:       DUF2370  [M=226]
Accession:   PF10176.9
Description: Protein of unknown function (DUF2370)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
      2e-13   36.6   7.9    2.2e-10   26.7   0.0    3.2  3  SwissProt::Q91ZP6  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q91ZP6  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !    1.8   2.8    0.0091    0.0091      37      74 ..     104     147 ..      63     155 .. 0.78
   2 !   26.7   0.0   2.2e-10   2.2e-10      38     127 ..     157     254 ..     149     261 .. 0.88
   3 !    9.5   0.2   3.8e-05   3.8e-05     188     223 ..     267     302 ..     261     305 .. 0.89

  Alignments for each domain:
  == domain 1  score: 1.8 bits;  conditional E-value: 0.0091
            DUF2370  37 ekpPtYeeAaa......DaaPpYwettvlapslesdevlvdGlp 74 
                         + Pt e+Aa       D+ PpY  +tv ap++++ +v+ +  p
  SwissProt::Q91ZP6 104 LAAPTVEAAASapaldpDSPPPYSSITVEAPTTSDTDVYSEFYP 147
                        45677777764444445999**************9999977666 PP

  == domain 2  score: 26.7 bits;  conditional E-value: 2.2e-10
            DUF2370  38 kpPtYeeAaaDaaPpYwettvlapsles.......devl.vdGlpvGnlfsfvwNllvsvsFqlvGFlltYlLHtthAakqGSraGLGitli 121
                        + PtY+eA +  a         ap+ ++       d+   v+ l vGn   f+    +++ F  +GF l++ +  t A + G+  G G+ li
  SwissProt::Q91ZP6 157 SLPTYDEAEKAKAAALAAAAADAPQRNQeedctprDDFSdVEQLRVGNDGIFMLAFFMAFIFNWLGFCLSFCITNTIAGRYGAICGFGLSLI 248
                        67999999999999999999999998888888998665449*************************************************** PP

            DUF2370 122 qygfsl 127
                        ++ + +
  SwissProt::Q91ZP6 249 KWILIV 254
                        986655 PP

  == domain 3  score: 9.5 bits;  conditional E-value: 3.8e-05
            DUF2370 188 sewlayvlmilGlfiliksvvdylrvkrlekkvlas 223
                        + wl +++ +lGl++  +++v+yl+v+ + +++ a+
  SwissProt::Q91ZP6 267 QYWLWWIFLVLGLLLFFRGFVNYLKVRNMSESMAAA 302
                        569999***********************9998766 PP



Or compare SwissProt::Q91ZP6 to CDD or PaperBLAST