PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS6581145 to PF10176 (DUF2370)

VIMSS6581145 has 321 amino acids

Query:       DUF2370  [M=226]
Accession:   PF10176.9
Description: Protein of unknown function (DUF2370)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    2.2e-90  288.3   0.1      3e-90  287.9   0.1    1.1  1  VIMSS6581145  


Domain annotation for each sequence (and alignments):
>> VIMSS6581145  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  287.9   0.1     3e-90     3e-90      10     225 ..      96     318 ..      87     319 .. 0.86

  Alignments for each domain:
  == domain 1  score: 287.9 bits;  conditional E-value: 3e-90
       DUF2370  10 vg..........kgagndGVFaNlsAkPdree..eeekeekpPtYeeAaaDaaPpYwettvlapslesdevlvdGlpvGnlfsfvwNllvsvsFqlv 94 
                   ++          +ga+ dGVF+NlsAkPd++e   +++++ pPtY+eAaaD+aP+Y+++++ ++++++de++++GlpvGn+++++wN++vs+sFq++
  VIMSS6581145  96 FKkrtqqssdiqQGAMFDGVFSNLSAKPDTTEteGNNEQDIPPTYDEAAADMAPSYYGMDLNNSDIYYDEICIEGLPVGNIANLLWNIIVSTSFQFI 192
                   5555555555559****************87766678999********************************************************* PP

       DUF2370  95 GFlltYlLHtthAakqGSraGLGitliqygfslrssaeeskvkkekeegrvepsdpnshdldkekvaekgekeeaaalsdlelaeeeknkesssewl 191
                   GFl+tY+LHt+hAakqGSr+GLG+t+i yg+s+++++++skv+k+k+ +r+e +dpn++d  + ++   +++++++   + +l++  ++++++ +wl
  VIMSS6581145 193 GFLITYILHTSHAAKQGSRFGLGLTFIGYGYSMIPNDVTSKVGKNKSLNRMELEDPNEFDDVRLNS---QSTTQDK--FESHLNHGLDEEKQNIPWL 284
                   ***********************************************************9222222...2222222..233345555566799**** PP

       DUF2370 192 ayvlmilGlfiliksvvdylrvkrlekkvlased 225
                   a+++ +lGlfi++ks++dy++vk+lekk+l++++
  VIMSS6581145 285 AVFVAFLGLFITLKSIYDYIQVKKLEKKYLNQSQ 318
                   ******************************9976 PP



Or compare VIMSS6581145 to CDD or PaperBLAST