PaperBLAST – Find papers about a protein or its homologs

 

Align XP_006526212.1 to PF10176 (DUF2370)

XP_006526212.1 has 221 amino acids

Query:       DUF2370  [M=226]
Accession:   PF10176.9
Description: Protein of unknown function (DUF2370)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    2.7e-15   42.7   7.3    7.2e-12   31.5   0.0    3.1  3  XP_006526212.1  


Domain annotation for each sequence (and alignments):
>> XP_006526212.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !    3.9   1.5    0.0021    0.0021      32      63 ..      21      52 ..       7      62 .. 0.81
   2 !   31.5   0.0   7.2e-12   7.2e-12      38     127 ..      63     164 ..      54     171 .. 0.86
   3 !    9.8   0.1   3.2e-05   3.2e-05     189     220 ..     178     209 ..     174     215 .. 0.88

  Alignments for each domain:
  == domain 1  score: 3.9 bits;  conditional E-value: 0.0021
         DUF2370 32 eeekeekpPtYeeAaaDaaPpYwettvlapsl 63
                    + ++ee+p   e+ a Da PpY  +t  ++++
  XP_006526212.1 21 QLQNEEEPGEPEQTAGDAPPPYSSITAESAAY 52
                    45689999999***********9999887765 PP

  == domain 2  score: 31.5 bits;  conditional E-value: 7.2e-12
         DUF2370  38 kpPtYeeAaaDaaPpYwettvlapsles.............dev.lvdGlpvGnlfsfvwNllvsvsFqlvGFlltYlLHtthAakqGSraGLGi 118
                     kpP+Y+ A+  + P+Y e + + ++++              d+    d l +Gn   f+    +++ F  +GF+l++ L t+ A + G+  G G+
  XP_006526212.1  63 KPPSYNVAT--TLPSYDEAERTKTEATIplvpgrdedfvgrDDFdDTDQLRIGNDGIFMLTFFMAFLFNWIGFFLSFCLTTSAAGRYGAISGFGL 155
                     799999886..68999999998888887899999888888844323699********************************************** PP

         DUF2370 119 tliqygfsl 127
                      li++ + +
  XP_006526212.1 156 SLIKWILIV 164
                     ***986655 PP

  == domain 3  score: 9.8 bits;  conditional E-value: 3.2e-05
         DUF2370 189 ewlayvlmilGlfiliksvvdylrvkrlekkv 220
                      wl +v+ +lG+++ ++++++y +v+++ +++
  XP_006526212.1 178 YWLWWVFLVLGFLLFLRGFINYAKVRKMPETF 209
                     69999**********************98776 PP



Or compare XP_006526212.1 to CDD or PaperBLAST