PaperBLAST – Find papers about a protein or its homologs

 

Align CAZy::CAZ96583.1 to PF10287 (DUF2401)

CAZy::CAZ96583.1 has 383 amino acids

Query:       DUF2401  [M=229]
Accession:   PF10287.9
Description: Putative TOS1-like glycosyl hydrolase (DUF2401)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence         Description
    ------- ------ -----    ------- ------ -----   ---- --  --------         -----------
    2.8e-09   23.0   0.2    6.5e-09   21.8   0.0    1.8  2  CAZy::CAZ96583.1  


Domain annotation for each sequence (and alignments):
>> CAZy::CAZ96583.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -2.8   0.0      0.22      0.22     155     200 ..      66     115 ..      64     140 .. 0.64
   2 !   21.8   0.0   6.5e-09   6.5e-09     119     177 ..     236     294 ..     217     354 .. 0.85

  Alignments for each domain:
  == domain 1  score: -2.8 bits;  conditional E-value: 0.22
           DUF2401 155 ifEvlesgseklkstlhtaqgae....gggssdyfeRptdetikvavvfd 200
                       i+Ev +s+s+ +   + +++g      +g +++ f+ + +++ +++v+  
  CAZy::CAZ96583.1  66 IVEVSASASNAVRYAFRFENGDVedstDGSTTHTFTEEGTHPYTIVVWAY 115
                       67888888888888887777766666544455555555555555555544 PP

  == domain 2  score: 21.8 bits;  conditional E-value: 6.5e-09
           DUF2401 119 kdmPAiWlLnakiprtaqYpgnaeCsCwksgCGelDifEvlesgseklkstlhtaqgae 177
                          PAiW+L a+   t +Y g++  +     CGe+Di+E    ++e+ ++++h ++ ++
  CAZy::CAZ96583.1 236 GTWPAIWTLGANSNETGNYFGEQYGNAEWPACGEIDILEQNGWDKESTIAHFHWSDLNS 294
                       568****************99999999889*********99999*********988543 PP



Or compare CAZy::CAZ96583.1 to CDD or PaperBLAST