PaperBLAST – Find papers about a protein or its homologs

 

Align CharProtDB::CH_122922 to PF10287 (DUF2401)

CharProtDB::CH_122922 has 384 amino acids

Query:       DUF2401  [M=229]
Accession:   PF10287.9
Description: Putative TOS1-like glycosyl hydrolase (DUF2401)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence              Description
    ------- ------ -----    ------- ------ -----   ---- --  --------              -----------
    3.3e-86  274.7   4.0    3.3e-86  274.7   4.0    1.8  2  CharProtDB::CH_122922  


Domain annotation for each sequence (and alignments):
>> CharProtDB::CH_122922  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.7   0.2     0.048     0.048      31      72 ..      33      74 ..      13      76 .. 0.76
   2 !  274.7   4.0   3.3e-86   3.3e-86       1     229 []     101     334 ..     101     334 .. 0.96

  Alignments for each domain:
  == domain 1  score: -0.7 bits;  conditional E-value: 0.048
                DUF2401 31 sGvfdsalgnslsyassdgtsgassptvledvllssnkEiii 72
                           sG+++++ + s  y +s ++++ ++   +++++++ n+E+++
  CharProtDB::CH_122922 33 SGTYNQVEKLSNIYKDSCSCEVNKTLVSFSGTNAPLNEEVSV 74
                           788888888888888888888888888888888888888876 PP

  == domain 2  score: 274.7 bits;  conditional E-value: 3.3e-86
                DUF2401   1 gswkrvayYnaesgtaenlvFlnnkggksgsGvfdsalgnslsyassdgtsgassptvledvll.ssnkEiiifsdkkCe....dkdC 83 
                            g+wkr +yY+ +sgt+en++Fl+++g++s+      +lg  l+ya +dg+s+a+s+tvl++++l +sn+E++ifs+ +C     ++dC
  CharProtDB::CH_122922 101 GDWKRLSYYEGSSGTSENVTFLTSAGKNSS------CLGIGLTYAGTDGISKADSSTVLAKNTLiNSNDEFVIFSNISCGksgyNNDC 182
                            69************************9665......***********************887766**************999999*** PP

                DUF2401  84 gyyregivayhGfgGakkvflfefsmpedkksssn...kdmPAiWlLnakiprtaqYpgnaeCsCwksgCGelDifEvlesg.seklk 167
                            g+yr++i+ayhGf+G++k+flfef+mp+++++s++   ++mPAiWlLna+iprtaqY++n +CsCw+sgCGe+DifEv++s+   +++
  CharProtDB::CH_122922 183 GVYRSDIPAYHGFYGTTKMFLFEFQMPNETHTSTDisnYNMPAIWLLNAHIPRTAQYSMNVNCSCWRSGCGEFDIFEVMNSTeYLHMY 270
                            ****************************9998884445******************************************99889*** PP

                DUF2401 168 stlhtaqgae....gggssdyfeRptdetikvavvfdseestvkivelddstdfdeslsaetvesl 229
                            st+h++qg++    g+ +  y+eR+ ++t++++v fds++  + +v +++st+fd++++a++v+s+
  CharProtDB::CH_122922 271 STIHDYQGSDdiqtGMAAPAYIERDLTGTMSGGVAFDSSG--NAVVWVSNSTSFDSTIQASSVNSW 334
                            ********9999999999**********************..99********************99 PP



Or compare CharProtDB::CH_122922 to CDD or PaperBLAST