CharProtDB::CH_122922 has 384 amino acids
Query: YJL171C_Tos1_C [M=228] Accession: PF10287.13 Description: Cell wall protein YJL171C/Tos1, C-terminal Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-90 289.1 4.3 1.3e-90 289.1 4.3 1.7 2 CharProtDB::CH_122922 Domain annotation for each sequence (and alignments): >> CharProtDB::CH_122922 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.8 0.1 0.11 0.11 31 71 .. 33 73 .. 16 75 .. 0.67 2 ! 289.1 4.3 1.3e-90 1.3e-90 1 228 [] 101 334 .. 101 334 .. 0.97 Alignments for each domain: == domain 1 score: -1.8 bits; conditional E-value: 0.11 YJL171C_Tos1_C 31 sGvfdsalgnslsyassdgvsgassptvledetlssnkEiv 71 sG+++++ + s y +s +++ ++ +++++++ n+E++ CharProtDB::CH_122922 33 SGTYNQVEKLSNIYKDSCSCEVNKTLVSFSGTNAPLNEEVS 73 66777777777777777777777777777777777777665 PP == domain 2 score: 289.1 bits; conditional E-value: 1.3e-90 YJL171C_Tos1_C 1 gswkrvayYnaesqtaenvtFlnneggksgsGvfdsalgnslsyassdgvsgassptvledetl.ssnkEivifsdkkCs....dkdC 83 g+wkr +yY+ +s+t+envtFl+ +g++s+ +lg l+ya +dg+s+a+s+tvl+++tl +sn+E+vifs+ +C ++dC CharProtDB::CH_122922 101 GDWKRLSYYEGSSGTSENVTFLTSAGKNSS------CLGIGLTYAGTDGISKADSSTVLAKNTLiNSNDEFVIFSNISCGksgyNNDC 182 69************************9776......***********************998877**************999*9**** PP YJL171C_Tos1_C 84 gyyregivayhGfgGakkiflfefempedtksssn...admPAiWlLnakiprtsqY.gnasCsCwksgCGelDifevlnsg.seklk 166 g+yr++i+ayhGf+G++k+flfef+mp++t++s++ ++mPAiWlLna+iprt+qY +n +CsCw+sgCGe+Difev+ns+ +++ CharProtDB::CH_122922 183 GVYRSDIPAYHGFYGTTKMFLFEFQMPNETHTSTDisnYNMPAIWLLNAHIPRTAQYsMNVNCSCWRSGCGEFDIFEVMNSTeYLHMY 270 ****************************9999985556*******************99**********************9899*** PP YJL171C_Tos1_C 167 stlhtaqgae...tgggssdyfeRptdgtmkvavvfdssetikivelddstdfdeslsasevesl 228 st+h++qg++ tg+ + y+eR+ +gtm+++v fdss+ +++v++++st+fd++++as+v+s+ CharProtDB::CH_122922 271 STIHDYQGSDdiqTGMAAPAYIERDLTGTMSGGVAFDSSG-NAVVWVSNSTSFDSTIQASSVNSW 334 *********99999**************************.**********************99 PP
Or compare CharProtDB::CH_122922 to CDD or PaperBLAST