Q59L72 has 384 amino acids
Query: YJL171C_Tos1_C [M=228] Accession: PF10287.13 Description: Cell wall protein YJL171C/Tos1, C-terminal Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-90 289.2 8.6 1.3e-90 289.1 4.3 2.0 2 Q59L72 Domain annotation for each sequence (and alignments): >> Q59L72 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 2.3 0.1 0.0062 0.0062 24 72 .. 29 74 .. 12 78 .. 0.83 2 ! 289.1 4.3 1.3e-90 1.3e-90 1 228 [] 101 334 .. 101 334 .. 0.97 Alignments for each domain: == domain 1 score: 2.3 bits; conditional E-value: 0.0062 YJL171C_Tos1_C 24 neggksgsGvfdsalgnslsyassdgvsgassptvledetlssnkEivi 72 n g sG+++++ + s y +s +++ ++p +++++++ n+E+++ Q59L72 29 NLGF---SGTYNQVEKLSNIYKDSCSCEVNKTPVSFSGTNAPLNEEVSV 74 4444...89************************************9987 PP == domain 2 score: 289.1 bits; conditional E-value: 1.3e-90 YJL171C_Tos1_C 1 gswkrvayYnaesqtaenvtFlnneggksgsGvfdsalgnslsyassdgvsgassptvledetl.ssnkEivifsdkkCs....dkdCgyyregi 90 g+wkr +yY+ +s+t+envtFl+ +g++s+ +lg l+ya +dg+s+a+s+tvl+++tl +sn+E+vifs+ +C ++dCg+yr++i Q59L72 101 GDWKRLSYYEGSSGTSENVTFLTSAGKNSS------CLGIGLTYAGTDGISKADSSTVLAKNTLiNSNDEFVIFSNISCGksgyNNDCGVYRSDI 189 69************************9776......***********************998877**************999*9*********** PP YJL171C_Tos1_C 91 vayhGfgGakkiflfefempedtksssn...admPAiWlLnakiprtsqY.gnasCsCwksgCGelDifevlnsg.seklkstlhtaqgae...t 177 +ayhGf+G++k+flfef+mp++t++s++ ++mPAiWlLna+iprt+qY +n +CsCw+sgCGe+Difev+ns+ +++st+h++qg++ t Q59L72 190 PAYHGFYGTTKMFLFEFQMPNETHTSTDisnYNMPAIWLLNAHIPRTAQYsMNVNCSCWRSGCGEFDIFEVMNSTeYLHMYSTIHDYQGSDdiqT 284 *********************9999985556*******************99**********************9899************99999 PP YJL171C_Tos1_C 178 gggssdyfeRptdgtmkvavvfdssetikivelddstdfdeslsasevesl 228 g+ + y+eR+ +gtm+++v fdss+ +++v++++st+fd++++as+v+s+ Q59L72 285 GMAAPAYIERDLTGTMSGGVAFDSSG-NAVVWVSNSTSFDSTIQASSVNSW 334 **************************.**********************99 PP
Or compare Q59L72 to CDD or PaperBLAST