PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS6579320 to PF10287 (DUF2401)

VIMSS6579320 has 507 amino acids

Query:       DUF2401  [M=229]
Accession:   PF10287.9
Description: Putative TOS1-like glycosyl hydrolase (DUF2401)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    4.3e-94  300.5   2.1    4.3e-94  300.5   2.1    2.2  2  VIMSS6579320  


Domain annotation for each sequence (and alignments):
>> VIMSS6579320  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -2.1   0.2      0.14      0.14      40      69 ..      52      81 ..      27      85 .. 0.58
   2 !  300.5   2.1   4.3e-94   4.3e-94       1     229 []     264     495 ..     264     495 .. 0.98

  Alignments for each domain:
  == domain 1  score: -2.1 bits;  conditional E-value: 0.14
       DUF2401 40 nslsyassdgtsgassptvledvllssnkE 69
                  n ++ ++++++s++s+p+   ++l++ ++E
  VIMSS6579320 52 NEITNMDTSSCSCSSTPKSYGGNLAPFDEE 81
                  444445555555555555555555555555 PP

  == domain 2  score: 300.5 bits;  conditional E-value: 4.3e-94
       DUF2401   1 gswkrvayYnaesgtaenlvFlnnkggksgsGvfdsalgnslsyassdgtsgassptvledvllssnkEiiifsdkkCedkdCgyyregivayhGfg 97 
                   ++w r+++Y+a+sgt++n+vFlnn+gg++gsGv++s++gnsls+a+s+g++gass++vle+ l++s+kE++i+++++C ++dCgyy +gi+ayhGf+
  VIMSS6579320 264 SDWGRSSFYEADSGTSDNIVFLNNMGGSAGSGVWSSCFGNSLSFAASNGVDGASSSQVLENILVASDKEFSIWTATEC-NNDCGYYLPGIPAYHGFS 359
                   58****************************************************************************.9***************** PP

       DUF2401  98 GakkvflfefsmpedkksssnkdmPAiWlLnakiprtaqYpgnaeCsCwksgCGelDifEvlesgseklkstlhtaqgae.....gggssdyfeRpt 189
                   Ga k++l+ef mp+d++ss n+dmPAiW Lna+iprt qY gna+CsCw++gCGe+DifEvl++g+ek++ tlh +qg++     g+gssdyf+Rpt
  VIMSS6579320 360 GA-KLVLMEFIMPHDSSSSYNQDMPAIWSLNAQIPRTLQY-GNADCSCWTTGCGEFDIFEVLSTGNEKMIPTLHGSQGSSngnggGAGSSDYFARPT 454
                   *9.9************************************.79***********************************999999999********** PP

       DUF2401 190 detikvavvfdseestvkiveldds.tdfdeslsaetvesl 229
                   ++++ +av++d+++s ++i+ ++d+ ++fd++ sa++v+++
  VIMSS6579320 455 SSSMIGAVIYDTSSSGIYIIDVTDQnVSFDSTYSASDVDAW 495
                   **************999999888877************998 PP



Or compare VIMSS6579320 to CDD or PaperBLAST