PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS6583700 to PF10287 (DUF2401)

VIMSS6583700 has 396 amino acids

Query:       DUF2401  [M=229]
Accession:   PF10287.9
Description: Putative TOS1-like glycosyl hydrolase (DUF2401)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    2.9e-87  278.2   1.4    3.9e-87  277.7   1.4    1.2  1  VIMSS6583700  


Domain annotation for each sequence (and alignments):
>> VIMSS6583700  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  277.7   1.4   3.9e-87   3.9e-87       1     228 [.     105     338 ..     105     339 .. 0.96

  Alignments for each domain:
  == domain 1  score: 277.7 bits;  conditional E-value: 3.9e-87
       DUF2401   1 gswkrvayYnaesgtaenlvFlnnkggksgsGvfdsalgnslsyassdgtsgassptvledvll.ssnkEiiifsdkkCe....dkdCgyyregiva 92 
                   ++w+r ayY+++s+ta+n++Fln+ g+ s       +lgn+lsyass+gt++as++tvl+d +l ss++E+ii+s+ +C     dk Cg+yr+gi+a
  VIMSS6583700 105 SDWNRLAYYESSSKTADNVTFLNHGGEASP------CLGNALSYASSNGTGSASEATVLADGTLiSSDQEYIIYSNVSCPksgyDKGCGVYRSGIPA 195
                   58************************9777......***********************987665***************9999************* PP

       DUF2401  93 yhGfgGakkvflfefsmpedkksssn....kdmPAiWlLnakiprtaqYpgnaeCsCwksgCGelDifEvlesg.seklkstlhtaqgae....ggg 180
                   y+G+gG++k+flfef+mp++++++s+    +d+PAiWlLn++i+rt+qYp+na+CsCw+sgCGe+DifE ++ + +++l+st+ht+qg+e    g++
  VIMSS6583700 196 YYGYGGTTKMFLFEFEMPTETEKNSSsigyYDLPAIWLLNDHIARTSQYPTNANCSCWASGCGEYDIFEAMNGTeKNHLYSTFHTFQGIEdlgtGIQ 292
                   *******************99998877999******************************************9989*************99*9999* PP

       DUF2401 181 ssdyfeRptdetikvavvfdseestvkivelddstdfdeslsaetves 228
                   s  y++R+t++t+k++vvfds++  + +++++d t f+ ++sa+tv++
  VIMSS6583700 293 SYGYITRNTTGTMKGGVVFDSSG--NVVSFISDATPFNGTVSADTVND 338
                   ***********************..99*******************97 PP



Or compare VIMSS6583700 to CDD or PaperBLAST