PaperBLAST – Find papers about a protein or its homologs

 

Align WP_006989208.1 to PF10287 (DUF2401)

WP_006989208.1 has 383 amino acids

Query:       DUF2401  [M=229]
Accession:   PF10287.9
Description: Putative TOS1-like glycosyl hydrolase (DUF2401)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
      1e-10   27.7   0.9    2.2e-10   26.6   0.1    1.9  2  WP_006989208.1  


Domain annotation for each sequence (and alignments):
>> WP_006989208.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -1.4   0.1     0.083     0.083      27      62 ..      89     124 ..      67     140 .. 0.62
   2 !   26.6   0.1   2.2e-10   2.2e-10     120     177 ..     237     294 ..     222     327 .. 0.86

  Alignments for each domain:
  == domain 1  score: -1.4 bits;  conditional E-value: 0.083
         DUF2401  27 gksgsGvfdsalgnslsyassdgtsgassptvledv 62 
                     ++s+sG +++++ +  +y+s+  + + s++  + ++
  WP_006989208.1  89 QESTSGIMEYTFTKEGTYTSNVVVWAYSESGQFVNE 124
                     456677777777777777776655554444444444 PP

  == domain 2  score: 26.6 bits;  conditional E-value: 2.2e-10
         DUF2401 120 dmPAiWlLnakiprtaqYpgnaeCsCwksgCGelDifEvlesgseklkstlhtaqgae 177
                       PAiW+L a+   t  + + +  s +  gCGe+Di+E    ++++++s++h  + ++
  WP_006989208.1 237 TWPAIWTLGANCNETGSFFEGQYGSGQWPGCGEIDIMEQTGWDKNTIISHFHWGDRNT 294
                     57*************99977777888889***********************988654 PP



Or compare WP_006989208.1 to CDD or PaperBLAST