PaperBLAST – Find papers about a protein or its homologs

 

Align CharProtDB::CH_122814 to PF10290 (DUF2403)

CharProtDB::CH_122814 has 468 amino acids

Query:       DUF2403  [M=63]
Accession:   PF10290.9
Description: Glycine-rich protein domain (DUF2403)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence              Description
    ------- ------ -----    ------- ------ -----   ---- --  --------              -----------
    1.6e-31   94.9   0.8    4.3e-31   93.5   0.1    2.2  2  CharProtDB::CH_122814  


Domain annotation for each sequence (and alignments):
>> CharProtDB::CH_122814  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   93.5   0.1   4.3e-31   4.3e-31       2      63 .]      37      98 ..      36      98 .. 0.98
   2 ?   -2.7   0.1      0.48      0.48      10      36 ..     383     409 ..     380     425 .. 0.65

  Alignments for each domain:
  == domain 1  score: 93.5 bits;  conditional E-value: 4.3e-31
                DUF2403  2 aitytnvggsGsYkeVtsmdessgeCeteeksfsGplaPldeelSvhfRGPlkLkqfavYtp 63
                           ++ y+++g+sGsY++Vt+mde++g+C+++ +sfsG+l+PldeelSvhfRGPl+L qf+vY+p
  CharProtDB::CH_122814 37 KVIYKGIGFSGSYMDVTNMDENTGKCTQQLYSFSGNLSPLDEELSVHFRGPLTLLQFGVYYP 98
                           799*********************************************************96 PP

  == domain 2  score: -2.7 bits;  conditional E-value: 0.48
                DUF2403  10 gsGsYkeVtsmdessgeCeteeksfsG 36 
                             sGs k ++++++++g+ + +++   G
  CharProtDB::CH_122814 383 SSGSNKMISHLHDGQGSSQNSNNGGGG 409
                            678888888888887776666555544 PP



Or compare CharProtDB::CH_122814 to CDD or PaperBLAST