H0GRF2 has 458 amino acids
Query: YJL171C_Tos1_N [M=63] Accession: PF10290.13 Description: Cell wall protein YJL171C/Tos1, N-terminal Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-31 94.5 0.2 6.8e-31 92.9 0.1 2.0 2 H0GRF2 Domain annotation for each sequence (and alignments): >> H0GRF2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 92.9 0.1 6.8e-31 6.8e-31 1 63 [] 38 100 .. 38 100 .. 0.98 2 ? -3.2 0.0 0.68 0.68 11 21 .. 172 182 .. 170 193 .. 0.74 Alignments for each domain: == domain 1 score: 92.9 bits; conditional E-value: 6.8e-31 YJL171C_Tos1_N 1 daieysnvgfsGsYkevtsmdessgsCeveeksfsGplaPldeelSvhfRGPlkLkqfavYtp 63 dai ysnvg s++Y++vt+mdess+ C+++e + sG+laP++eelS+hfRGP++L qf+vY+p H0GRF2 38 DAIIYSNVGLSATYQDVTKMDESSCVCTQAEFTASGSLAPFNEELSIHFRGPIELLQFGVYYP 100 689**********************************************************96 PP == domain 2 score: -3.2 bits; conditional E-value: 0.68 YJL171C_Tos1_N 11 sGsYkevtsmd 21 +sY++v+++ H0GRF2 172 PSSYNKVSTVL 182 57899998765 PP
Or compare H0GRF2 to CDD or PaperBLAST