PaperBLAST – Find papers about a protein or its homologs

 

Align H0GRF2 to PF10290 (YJL171C_Tos1_N)

H0GRF2 has 458 amino acids

Query:       YJL171C_Tos1_N  [M=63]
Accession:   PF10290.13
Description: Cell wall protein YJL171C/Tos1, N-terminal
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    2.1e-31   94.5   0.2    6.8e-31   92.9   0.1    2.0  2  H0GRF2    


Domain annotation for each sequence (and alignments):
>> H0GRF2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   92.9   0.1   6.8e-31   6.8e-31       1      63 []      38     100 ..      38     100 .. 0.98
   2 ?   -3.2   0.0      0.68      0.68      11      21 ..     172     182 ..     170     193 .. 0.74

  Alignments for each domain:
  == domain 1  score: 92.9 bits;  conditional E-value: 6.8e-31
  YJL171C_Tos1_N   1 daieysnvgfsGsYkevtsmdessgsCeveeksfsGplaPldeelSvhfRGPlkLkqfavYtp 63 
                     dai ysnvg s++Y++vt+mdess+ C+++e + sG+laP++eelS+hfRGP++L qf+vY+p
          H0GRF2  38 DAIIYSNVGLSATYQDVTKMDESSCVCTQAEFTASGSLAPFNEELSIHFRGPIELLQFGVYYP 100
                     689**********************************************************96 PP

  == domain 2  score: -3.2 bits;  conditional E-value: 0.68
  YJL171C_Tos1_N  11 sGsYkevtsmd 21 
                      +sY++v+++ 
          H0GRF2 172 PSSYNKVSTVL 182
                     57899998765 PP



Or compare H0GRF2 to CDD or PaperBLAST