PaperBLAST – Find papers about a protein or its homologs

 

Align P38288 to PF10290 (YJL171C_Tos1_N)

P38288 has 455 amino acids

Query:       YJL171C_Tos1_N  [M=63]
Accession:   PF10290.13
Description: Cell wall protein YJL171C/Tos1, N-terminal
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    4.6e-32   96.6   0.0    1.3e-31   95.1   0.0    1.9  1  P38288    


Domain annotation for each sequence (and alignments):
>> P38288  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   95.1   0.0   1.3e-31   1.3e-31       1      63 []      38     100 ..      38     100 .. 0.98

  Alignments for each domain:
  == domain 1  score: 95.1 bits;  conditional E-value: 1.3e-31
  YJL171C_Tos1_N   1 daieysnvgfsGsYkevtsmdessgsCeveeksfsGplaPldeelSvhfRGPlkLkqfavYtp 63 
                     dai ysnvg s++Y++vt+mdess++C++++ + sG+laP++eelSvhfRGP++L qf+vY+p
          P38288  38 DAIIYSNVGLSATYQDVTNMDESSCACTQADFTASGSLAPFNEELSVHFRGPIELLQFGVYYP 100
                     689**********************************************************96 PP



Or compare P38288 to CDD or PaperBLAST