PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS6579320 to PF10290 (DUF2403)

VIMSS6579320 has 507 amino acids

Query:       DUF2403  [M=63]
Accession:   PF10290.9
Description: Glycine-rich protein domain (DUF2403)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    3.8e-31   93.7   0.3    9.4e-31   92.4   0.3    1.7  1  VIMSS6579320  


Domain annotation for each sequence (and alignments):
>> VIMSS6579320  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   92.4   0.3   9.4e-31   9.4e-31       2      63 .]      39     100 ..      38     100 .. 0.98

  Alignments for each domain:
  == domain 1  score: 92.4 bits;  conditional E-value: 9.4e-31
       DUF2403   2 aitytnvggsGsYkeVtsmdessgeCeteeksfsGplaPldeelSvhfRGPlkLkqfavYtp 63 
                   ++++tnvg+s++Y+e+t+md+ss++C++++ks+ G+laP+dee S+hfRGP++Lk+favY+p
  VIMSS6579320  39 EVEFTNVGYSSTYNEITNMDTSSCSCSSTPKSYGGNLAPFDEEFSFHFRGPIELKRFAVYYP 100
                   799*********************************************************96 PP



Or compare VIMSS6579320 to CDD or PaperBLAST