PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS6581014 to PF10290 (DUF2403)

VIMSS6581014 has 455 amino acids

Query:       DUF2403  [M=63]
Accession:   PF10290.9
Description: Glycine-rich protein domain (DUF2403)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    1.7e-31   94.8   0.0    5.1e-31   93.3   0.0    1.9  1  VIMSS6581014  


Domain annotation for each sequence (and alignments):
>> VIMSS6581014  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   93.3   0.0   5.1e-31   5.1e-31       1      63 []      38     100 ..      38     100 .. 0.98

  Alignments for each domain:
  == domain 1  score: 93.3 bits;  conditional E-value: 5.1e-31
       DUF2403   1 daitytnvggsGsYkeVtsmdessgeCeteeksfsGplaPldeelSvhfRGPlkLkqfavYtp 63 
                   dai y+nvg s++Y++Vt+mdess++C++++ + sG+laP++eelSvhfRGP++L qf+vY+p
  VIMSS6581014  38 DAIIYSNVGLSATYQDVTNMDESSCACTQADFTASGSLAPFNEELSVHFRGPIELLQFGVYYP 100
                   589**********************************************************96 PP



Or compare VIMSS6581014 to CDD or PaperBLAST