VIMSS6581014 has 455 amino acids
Query: YJL171C_Tos1_N [M=63]
Accession: PF10290.13
Description: Cell wall protein YJL171C/Tos1, N-terminal
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.6e-32 96.6 0.0 1.3e-31 95.1 0.0 1.9 1 VIMSS6581014
Domain annotation for each sequence (and alignments):
>> VIMSS6581014
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 95.1 0.0 1.3e-31 1.3e-31 1 63 [] 38 100 .. 38 100 .. 0.98
Alignments for each domain:
== domain 1 score: 95.1 bits; conditional E-value: 1.3e-31
YJL171C_Tos1_N 1 daieysnvgfsGsYkevtsmdessgsCeveeksfsGplaPldeelSvhfRGPlkLkqfavYtp 63
dai ysnvg s++Y++vt+mdess++C++++ + sG+laP++eelSvhfRGP++L qf+vY+p
VIMSS6581014 38 DAIIYSNVGLSATYQDVTNMDESSCACTQADFTASGSLAPFNEELSVHFRGPIELLQFGVYYP 100
689**********************************************************96 PP
Or compare VIMSS6581014 to CDD or PaperBLAST