XP_001587233.1 has 492 amino acids
Query: YJL171C_Tos1_N [M=63] Accession: PF10290.13 Description: Cell wall protein YJL171C/Tos1, N-terminal Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.5e-31 92.9 0.8 1.2e-30 92.1 0.1 1.9 2 XP_001587233.1 Domain annotation for each sequence (and alignments): >> XP_001587233.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 92.1 0.1 1.2e-30 1.2e-30 1 63 [] 35 96 .. 35 96 .. 0.97 2 ? -3.5 0.1 0.83 0.83 10 21 .. 253 264 .. 248 268 .. 0.73 Alignments for each domain: == domain 1 score: 92.1 bits; conditional E-value: 1.2e-30 YJL171C_Tos1_N 1 daieysnvgfsGsYkevtsmdessgsCeveeksfsGplaPldeelSvhfRGPlkLkqfavYtp 63 dai ysnvg G+Y++vt+m s+g C+++++s+sGp++Pldee+S+hfRGPl+LkqfavYtp XP_001587233.1 35 DAILYSNVGSPGTYNQVTDMA-SNGICSSSPRSYSGPISPLDEEVSFHFRGPLQLKQFAVYTP 96 689******************.79*************************************96 PP == domain 2 score: -3.5 bits; conditional E-value: 0.83 YJL171C_Tos1_N 10 fsGsYkevtsmd 21 +sGsY+++ d XP_001587233.1 253 GSGSYSRIGYYD 264 589998876555 PP
Or compare XP_001587233.1 to CDD or PaperBLAST