PaperBLAST – Find papers about a protein or its homologs

 

Align XP_001587233.1 to PF10290 (YJL171C_Tos1_N)

XP_001587233.1 has 492 amino acids

Query:       YJL171C_Tos1_N  [M=63]
Accession:   PF10290.13
Description: Cell wall protein YJL171C/Tos1, N-terminal
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    6.5e-31   92.9   0.8    1.2e-30   92.1   0.1    1.9  2  XP_001587233.1  


Domain annotation for each sequence (and alignments):
>> XP_001587233.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   92.1   0.1   1.2e-30   1.2e-30       1      63 []      35      96 ..      35      96 .. 0.97
   2 ?   -3.5   0.1      0.83      0.83      10      21 ..     253     264 ..     248     268 .. 0.73

  Alignments for each domain:
  == domain 1  score: 92.1 bits;  conditional E-value: 1.2e-30
  YJL171C_Tos1_N  1 daieysnvgfsGsYkevtsmdessgsCeveeksfsGplaPldeelSvhfRGPlkLkqfavYtp 63
                    dai ysnvg  G+Y++vt+m  s+g C+++++s+sGp++Pldee+S+hfRGPl+LkqfavYtp
  XP_001587233.1 35 DAILYSNVGSPGTYNQVTDMA-SNGICSSSPRSYSGPISPLDEEVSFHFRGPLQLKQFAVYTP 96
                    689******************.79*************************************96 PP

  == domain 2  score: -3.5 bits;  conditional E-value: 0.83
  YJL171C_Tos1_N  10 fsGsYkevtsmd 21 
                     +sGsY+++   d
  XP_001587233.1 253 GSGSYSRIGYYD 264
                     589998876555 PP



Or compare XP_001587233.1 to CDD or PaperBLAST