XP_036667304.1 has 444 amino acids
Query: YJL171C_Tos1_N [M=63]
Accession: PF10290.13
Description: Cell wall protein YJL171C/Tos1, N-terminal
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.2e-33 101.7 0.2 4e-33 100.0 0.2 2.0 1 XP_036667304.1
Domain annotation for each sequence (and alignments):
>> XP_036667304.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 100.0 0.2 4e-33 4e-33 2 63 .] 34 95 .. 33 95 .. 0.98
Alignments for each domain:
== domain 1 score: 100.0 bits; conditional E-value: 4e-33
YJL171C_Tos1_N 2 aieysnvgfsGsYkevtsmdessgsCeveeksfsGplaPldeelSvhfRGPlkLkqfavYtp 63
++ y+++gfsGsY++vt+mde+sgsC++e++sfsG+l+PldeelSvhfRGPlkL qf+vY+p
XP_036667304.1 34 KVVYKGIGFSGSYQDVTNMDEDSGSCSQESYSFSGNLSPLDEELSVHFRGPLKLLQFGVYYP 95
899*********************************************************96 PP
Or compare XP_036667304.1 to CDD or PaperBLAST