SwissProt::O94243 has 208 amino acids
Query: DUF2406 [M=64]
Accession: PF10295.13
Description: Uncharacterised protein (DUF2406)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.6e-17 50.3 0.0 4.3e-17 48.9 0.0 1.7 1 SwissProt::O94243
Domain annotation for each sequence (and alignments):
>> SwissProt::O94243
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 48.9 0.0 4.3e-17 4.3e-17 4 63 .. 18 74 .. 16 75 .. 0.82
Alignments for each domain:
== domain 1 score: 48.9 bits; conditional E-value: 4.3e-17
DUF2406 4 EaqPfeqaadkslaslrsiqrqsykDvfGnpiadpDlSNPtRsrdERPLDTIRsFeyait 63
E +P + ++++++ ++++ r +D G++i +pD NPtR + ERPL+TIR+++ +
SwissProt::O94243 18 ELEPYARVNRETTKLNKAHVR---RDYSGRSICQPDTNNPTRWKYERPLETIRAWQDVAE 74
778888877755555555555...9*****************************997665 PP
Or compare SwissProt::O94243 to CDD or PaperBLAST