PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS6579692 to PF10295 (DUF2406)

VIMSS6579692 has 124 amino acids

Query:       DUF2406  [M=64]
Accession:   PF10295.9
Description: Uncharacterised protein (DUF2406)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    2.9e-20   59.1   0.0    5.7e-20   58.1   0.0    1.4  1  VIMSS6579692  


Domain annotation for each sequence (and alignments):
>> VIMSS6579692  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   58.1   0.0   5.7e-20   5.7e-20       1      63 [.      12      71 ..      12      72 .. 0.85

  Alignments for each domain:
  == domain 1  score: 58.1 bits;  conditional E-value: 5.7e-20
       DUF2406  1 AvseaqPfeqaadklslaalrsiqrsykDvfGkeiadpDlSNPtRsRdERPLdTIRsFeaaie 63
                  A++e +P e a++ ++   ++s     kD +G++i++pD  NPtR R+ERPLdT+R++++ i+
  VIMSS6579692 12 AITELEPYEMAQT-NKEVPTTSLLS--KDYYGHSIEEPDENNPTRWRYERPLDTVRAWQYLID 71
                  79999***99888.33444444444..9********************************996 PP



Or compare VIMSS6579692 to CDD or PaperBLAST