PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001018404.3 to PF10300 (DUF3808)

NP_001018404.3 has 579 amino acids

Query:       DUF3808  [M=477]
Accession:   PF10300.9
Description: Protein of unknown function (DUF3808)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
   1.9e-127  411.9   2.0   2.3e-127  411.6   2.0    1.1  1  NP_001018404.3  


Domain annotation for each sequence (and alignments):
>> NP_001018404.3  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  411.6   2.0  2.3e-127  2.3e-127       2     477 .]      27     494 ..      26     494 .. 0.91

  Alignments for each domain:
  == domain 1  score: 411.6 bits;  conditional E-value: 2.3e-127
         DUF3808   2 qaldlvLndkfeeaeellkeaskeSslhalgrgviafleAvltfepekmkkAsealkeaeklceksrkkaqkne........skqnl..ssdsly 86 
                     q+++++Ln+ f+e++el++ ++++S l+++g ++++fl+A++tfe+ekm+ As++l+++eklce  +++a ++e        s      +s    
  NP_001018404.3  27 QGINMLLNNGFRESDELFRRYRTHSPLMSFGASFVSFLNAMMTFEEEKMQMASDDLRTTEKLCE--SDNAGVIEtirnkikkS--MDsgRSGVEI 117
                     89**************************************************************..88888888888777431..2212333345 PP

         DUF3808  87 epgleaevcyaealLlkAlLtflseslvefiKgglklRkaYqiykeilkeikklekkkrskteeeeesllseekn..........sqaeidefle 171
                       +l+ ++++a+++++ A+L+f++++l ++iKgg+ lRka+++y++++++i++l+++ r  ++ ++ +l s++ n          +++e+  +l+
  NP_001018404.3 118 VDRLQRQIIVADCQVYLAVLSFVKQELSAYIKGGWILRKAWKMYNKCYSDISQLQEACRRRSSDQQGALASDQANhntstgsggrVTDEVLDRLK 212
                     6799***************************************************9999888666555444444455778889999********* PP

         DUF3808 172 sGvnlgfGilqlviSllPpailklLsvvGFsGdreeGLrlLweasksrnlraalallaLlfYytgvvqvldiddg..lkapleeleelLlksrkr 264
                     + v++g+G+++l+iS++Pp++lk+ +++GF Gdr++GL++L +as+s++++a+la+laLl+Y+t+v++++++d g    a l e++++L+k    
  NP_001018404.3 213 GSVSFGYGLFHLCISMVPPHLLKIVNLLGFPGDRHQGLASLAYASESKDMKAPLATLALLWYHTVVQPFFALD-GsdSRAGLLEAKAILQKKAMV 306
                     ************************************************************************5.336799*************** PP

         DUF3808 265 fPksalwllfearieslkgnldeAlelleeiieesqselkqvkhlclfelaltlvylheykeaaesfleLlklskwSkalYtYlaaacllelgre 359
                     +P+s+l+++f++r+++l++++++Al+ +++++ e +s++++++h+cl+e++++ +++  +++a++sf++L ++s+wS+++Y+Yl+++c+++ g+ 
  NP_001018404.3 307 YPNSSLFIFFKGRVQRLECQINSALASFQDAL-EFASDQREIQHVCLYEIGWCSMIEMSFEDAFRSFERLKNESRWSQCYYAYLTGVCQGASGDL 400
                     *******************************9.9***********************************************************99 PP

         DUF3808 360 ekkaeakekaeelfkevpkllqkkagkslplekFilrKverfkarkkekkselldavlvspvlEliYvwngfsrmskeeleeesvkkleekaank 454
                            e a+ +f+ v+kl+++   k++++e+F+l+++e++++       +l   ++++ v E++Y+w+++ ++s  +l+   ++ l+      
  NP_001018404.3 401 -------EGAKGVFRDVQKLFKR---KNNQIEQFALKRAEKLRKV------SLTRELCILGVVEVLYLWKALPNCSSSKLQ-LMNQVLQG----- 473
                     .......88999***********...*****************96......56889************************9.66666622..... PP

         DUF3808 455 eseeeeDdel...lkkLLkglvlrrl 477
                           Dd++   lk+LL+g++ ++l
  NP_001018404.3 474 -----LDDQSsigLKHLLLGAIQKCL 494
                     .....344444779********9997 PP



Or compare NP_001018404.3 to CDD or PaperBLAST