PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001161813.1 to PF10300 (DUF3808)

NP_001161813.1 has 613 amino acids

Query:       DUF3808  [M=477]
Accession:   PF10300.9
Description: Protein of unknown function (DUF3808)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
     3e-164  533.3  11.3   7.7e-164  531.9  10.9    1.7  2  NP_001161813.1  


Domain annotation for each sequence (and alignments):
>> NP_001161813.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  531.9  10.9  7.7e-164  7.7e-164      10     477 .]      81     529 ..      79     529 .. 0.96
   2 ?   -1.3   0.0     0.037     0.037     272     296 ..     560     584 ..     555     591 .. 0.83

  Alignments for each domain:
  == domain 1  score: 531.9 bits;  conditional E-value: 7.7e-164
         DUF3808  10 dkfeeaeellkeaskeSslhalgrgviafleAvltfepekmkkAsealkeaeklceksrkkaqkne......skqnlssdslyepgleaevcyae 98 
                     d fe+a+e ++ ++keS++halg+++i +l+Avltfe+++++++ +a+k+a+++c+k+rkk +++e      s+++l  ++l+e++++ae+cyae
  NP_001161813.1  81 DVFEDALETIS-MAKESMYHALGYSTIVVLQAVLTFEQQDIQNGISAMKDALQTCQKYRKKYTVVEsfssllSRGSL--EQLSEEEMHAEICYAE 172
                     7799******8.789***************************************************99998888877..8*************** PP

         DUF3808  99 alLlkAlLtf.lseslvefiKgglklRkaYqiykeilkeikklekkkrskteeeeesllseeknsqaeideflesGvnlgfGilqlviSllPpai 192
                     +lL+kA+Ltf ++e++++fiKgglk+R++Yqiyke+l+ +++++k+          +        q+e    +e+Gv+lg G+++l++SllP++i
  NP_001161813.1 173 CLLQKAALTFvQDENMINFIKGGLKIRTSYQIYKECLSILHEIQKN----------K-------LQQEFFYEFEGGVKLGSGAFNLMLSLLPARI 250
                     *****************************************77621..........1.......3458999************************ PP

         DUF3808 193 lklLsvvGFsGdreeGLrlLweasksrnlraalallaLlfYytgvvqvldiddglkapleeleelLlksrkrfPksalwllfearieslkgnlde 287
                     ++lL+++GFsG+re GL +L+e+++ r++r+al++l++l+++t+++ +l++   ++++ +e+e+lL++++++fP+++l+l+++arie lkgnl+e
  NP_001161813.1 251 IRLLEFIGFSGNRELGLLQLREGASGRSMRSALCCLTILAFHTYISLILGT---GEVNVAEAERLLAPFLQQFPNGSLVLFYHARIELLKGNLEE 342
                     ***************************************************...89*************************************** PP

         DUF3808 288 AlelleeiieesqselkqvkhlclfelaltlvylheykeaaesfleLlklskwSkalYtYlaaacllelgreekkaeakekaeelfkevpkllqk 382
                     A+e+++++i + q+e+kq++hlc++el++++v+++++ +a+ + ++L+k+skwSka+Y++l+aa+l++l++e+  a++ e++++lf++v++l+q+
  NP_001161813.1 343 AQEVFQKCI-SVQEEWKQFHHLCYWELMWINVFQQNWMQAYYYSDLLCKESKWSKATYVFLKAAILSMLPEEDVVATN-ENVVTLFRQVDSLKQR 435
                     *********.9*************************************************************999999.**************** PP

         DUF3808 383 kagkslplekFilrKverfkarkkekkselldavlvspvlEliYvwngfsrmskeeleeesvkkleeka....anke.seeeeDdellkkLLkgl 472
                     +agks+p+ekF++rK++r++a+ +      + + l++p+lE++Yvwngfs++sk+++++e+++ ++eka    ++++ ++ ++Dde+l+kLLkg+
  NP_001161813.1 436 IAGKSIPTEKFAVRKARRYSASLP------APVKLILPALEMMYVWNGFSIVSKRKDLSENLLVTVEKAeaalQSQNfNSFSVDDECLVKLLKGC 524
                     *********************966......99*********************************999999887777677999************ PP

         DUF3808 473 vlrrl 477
                     +l++l
  NP_001161813.1 525 CLKNL 529
                     ***97 PP

  == domain 2  score: -1.3 bits;  conditional E-value: 0.037
         DUF3808 272 llfearieslkgnldeAlelleeii 296
                     l++ a ++  +g++d+A++ le++ 
  NP_001161813.1 560 LFELASLYKSQGEIDKAIKFLETAR 584
                     78889999************99764 PP



Or compare NP_001161813.1 to CDD or PaperBLAST