PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::P36114 to PF10300 (DUF3808)

SwissProt::P36114 has 725 amino acids

Query:       DUF3808  [M=477]
Accession:   PF10300.9
Description: Protein of unknown function (DUF3808)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
   1.2e-186  607.1   0.6   1.4e-186  606.9   0.6    1.0  1  SwissProt::P36114  


Domain annotation for each sequence (and alignments):
>> SwissProt::P36114  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  606.9   0.6  1.4e-186  1.4e-186       1     477 []      36     629 ..      36     629 .. 0.97

  Alignments for each domain:
  == domain 1  score: 606.9 bits;  conditional E-value: 1.4e-186
            DUF3808   1 lqaldlvLndkfeeaeellkea.....skeSslhalgrgviafleAvltfepekmkkAsealkeaeklceksrkkaqkneskqnlssdslye 87 
                        l+a+d+vL+d+++e+++ll+e+     s++ +++al+rgvi+fleA+l+fe+e+mkkAs +l++ae+l+ ksr++aqk+     + s+sly+
  SwissProt::P36114  36 LRAMDYVLDDNADEGLALLDESdakeaSDQ-TINALARGVIEFLEATLGFEAEEMKKASATLAKAEALSLKSRERAQKIG---LK-SSSLYP 122
                        58******************6666664666.9************************************************...44.569*** PP

            DUF3808  88 pgleaevcyaealLlkAlLtflseslvefiKgglklRkaYqiykeilkeikklekkkrskt............................... 148
                        pg++++v+y+e++Ll+AlL+++ses++e++K++lklRk+Y++++eil++ik+++k+k+ k+                               
  SwissProt::P36114 123 PGTVYAVTYTESCLLHALLMIFSESMMEAAKAILKLRKSYYMLQEILETIKAANKAKKLKItsgsedkestpatfitggdafnsvdipyelt 214
                        *********************************************************9999******************************* PP

            DUF3808 149 .....................................................eeeeesllseekn.sqaeideflesGvnlgfGilqlviS 186
                                                                             e +++++ls++ + sqa+idef++sGvnl+fGilq+viS
  SwissProt::P36114 215 peeqkdkdllqfaeqihsmrterlsgahignspainrlrgelglqamedlpeeEITDHKVLSDDIDlSQATIDEFVHSGVNLCFGILQVVIS 306
                        ***************************************************998999999999999************************** PP

            DUF3808 187 llPpailklLsvvGFsGdreeGLrlLweasksrnlraalallaLlfYytgvvqvldid.....................dg..lkapleele 255
                        llPpai+++LsvvGF+G+reeGLrl+w+a+k+rn++++++llaL+fYy+g++q++d d                     dg  l +p+++le
  SwissProt::P36114 307 LLPPAIGAVLSVVGFRGSREEGLRLVWKATKQRNVHGCIGLLALMFYYDGPFQFTDDDfdipaavkdssnsedsedeemDGptLLHPGKILE 398
                        *********************************************************66677888889999999999886678********* PP

            DUF3808 256 elLlksrkrfPksalwllfearieslkgnldeAlelleeiieesqselkqvkhlclfelaltlvylheykeaaesfleLlklskwSkalYtY 347
                        ++Ll+sr++fP+salwll+ear++s kg+l+eA++l+++i   s+++++qvk+l++f++a+tl++lh+y++aae++l+Ll++s+wS+a+YtY
  SwissProt::P36114 399 DALLQSRALFPNSALWLLNEARMLSGKGRLEEAVALMDSID-VSKIRMRQVKSLMIFDRAITLIHLHQYDRAAEDILSLLDISDWSHAFYTY 489
                        **************************************995.************************************************** PP

            DUF3808 348 laaacllelgre........ekkaeakekaeelfkevpkllqkkag..kslplekFilrKverfkarkke.kkselldavlvspvlEliYvw 428
                        +a++c+le++r+        +kk+e+++kaeel++++ +ll+kk++  k+lpl++FilrKve+fka+k+e   +++ld +++spv+E+ Y++
  SwissProt::P36114 490 FAGCCYLENWRMcemglmksDKKDEYQKKAEELIFTSVNLLGKKTFksKNLPLDRFILRKVEQFKAKKEElGVENPLDGIATSPVHEIAYFY 581
                        **********************************************99**********************99******************** PP

            DUF3808 429 ngfsrmskeeleeesvkkleekaanke.seeeeDdellkkLLkglvlrrl 477
                        ng++rms+e+le  ++k+l+e+ +n++ +  ++D+el+k+LL++l+lrrl
  SwissProt::P36114 582 NGYNRMSEEHLE-LTKKMLTEY-RNPAiEALDSDQELIKDLLVSLTLRRL 629
                        ************.999999888.69997889*****************97 PP



Or compare SwissProt::P36114 to CDD or PaperBLAST