PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q13099 to PF10300 (DUF3808)

SwissProt::Q13099 has 833 amino acids

Query:       DUF3808  [M=477]
Accession:   PF10300.9
Description: Protein of unknown function (DUF3808)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    1.8e-10   26.2   0.4    1.8e-10   26.2   0.4    2.4  2  SwissProt::Q13099  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q13099  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   26.2   0.4   1.8e-10   1.8e-10     260     371 ..     233     342 ..     204     392 .. 0.88
   2 ?   -1.9   0.1     0.058     0.058     276     333 ..     431     484 ..     426     522 .. 0.69

  Alignments for each domain:
  == domain 1  score: 26.2 bits;  conditional E-value: 1.8e-10
            DUF3808 260 ksrkrfPksalwllfearieslkgnldeAlelleeiieesqselkqvkhlclfelaltlvylheykeaaesfleLlklskwSkalYtYlaaa 351
                          +k f++  ++ ++ + i+  + n  +A++ + +++++  s  kq++  ++ ++++t++   +y++a++s ++++++    ka Y+    +
  SwissProt::Q13099 233 VKNKMFSNAGILKMNMGNIYLKQRNYSKAIKFYRMALDQVPSVNKQMRIKIMQNIGVTFIQAGQYSDAINSYEHIMSMAPNLKAGYN--LTI 322
                        45688*******************************************************************************987..568 PP

            DUF3808 352 cllelgreekkaeakekaee 371
                        c+ ++g+ ek+++a +k+ +
  SwissProt::Q13099 323 CYFAIGDREKMKKAFQKLIT 342
                        88888888887777666655 PP

  == domain 2  score: -1.9 bits;  conditional E-value: 0.058
            DUF3808 276 arieslkgnldeAlelleeiieesqselkqvkhlclfelaltlvylheykeaaesfle 333
                        a  +  +++ ++A+e+l+ + e+++s    vk+    +l+  + + +++ +a  +++ 
  SwissProt::Q13099 431 AVTYLRQKDYNQAVEILKVL-EKKDS---RVKSAAATNLSALYYMGKDFAQASSYADI 484
                        44555667777777777743.23333...35566666666666666777777666665 PP



Or compare SwissProt::Q13099 to CDD or PaperBLAST