PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q8BYY4 to PF10300 (DUF3808)

SwissProt::Q8BYY4 has 617 amino acids

Query:       DUF3808  [M=477]
Accession:   PF10300.9
Description: Protein of unknown function (DUF3808)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
   5.8e-169  548.8   7.5   1.3e-168  547.6   7.4    1.6  2  SwissProt::Q8BYY4  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q8BYY4  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  547.6   7.4  1.3e-168  1.3e-168       2     477 .]      76     533 ..      75     533 .. 0.96
   2 ?   -1.9   0.0     0.057     0.057     272     296 ..     564     588 ..     560     595 .. 0.79

  Alignments for each domain:
  == domain 1  score: 547.6 bits;  conditional E-value: 1.3e-168
            DUF3808   2 qaldlvLndkfeeaeellkeaskeSslhalgrgviafleAvltfepekmkkAsealkeaeklceksrkkaqkne......skqnlssdslye 87 
                        +al+l+L++kf++a+ell++++keS++halg+++i +l+Av+tfe+++++++ +a+k+a+++c+k+rkk +++e      s+++l  ++l+e
  SwissProt::Q8BYY4  76 EALNLFLSNKFKDALELLRPWAKESMYHALGYSTIVVLQAVMTFEQQDIQNGISAMKDALQTCQKYRKKCTVVEsfssllSRGSL--EQLSE 165
                        79************************************************************************99998888877..8**** PP

            DUF3808  88 pgleaevcyaealLlkAlLtf.lseslvefiKgglklRkaYqiykeilkeikklekkkrskteeeeesllseeknsqaeideflesGvnlgf 178
                        ++++ae+cyae+lL+kA+Ltf ++e++++fiKgglk+R++Yqiyke+l+ ++ ++k+k              +   +++    +e+Gv+lg+
  SwissProt::Q8BYY4 166 EEMHAEICYAECLLQKAALTFvQDENMINFIKGGLKIRTSYQIYKECLSILHVIQKNK--------------Q---EQHFFYEFEGGVKLGT 240
                        ****************************************************665211..............1...2468999********* PP

            DUF3808 179 GilqlviSllPpailklLsvvGFsGdreeGLrlLweasksrnlraalallaLlfYytgvvqvldiddglkapleeleelLlksrkrfPksal 270
                        G+++l++SllP++i++lL+++GFsG+r+ GL +L+e+++  ++r++l++l++l+++t+++ +l++   ++++  e+e+lL++++++fP+++l
  SwissProt::Q8BYY4 241 GAFNLMLSLLPARIIRLLEFIGFSGNRDLGLLQLREGASGSSMRSPLCCLTILAFHTYISLILGT---GEVNVVEAESLLAPFLQQFPNGSL 329
                        *****************************************************************...89********************** PP

            DUF3808 271 wllfearieslkgnldeAlelleeiieesqselkqvkhlclfelaltlvylheykeaaesfleLlklskwSkalYtYlaaacllelgreekk 362
                        +l+++arie lkgn ++A+e++ ++i + q+e+kq++hlc++el+++++y++++ +a+ + ++L+k+skwSka+Y++l+aa+l++l++ee +
  SwissProt::Q8BYY4 330 ILFYHARIELLKGNTEKAQETFRKCI-SVQEEWKQFHHLCYWELMWIHIYQQNWMQAYYYSDLLCKESKWSKATYVFLKAAILSMLPEEEVA 420
                        **************************.9*************************************************************888 PP

            DUF3808 363 aeakekaeelfkevpkllqkkagkslplekFilrKverfkarkkekkselldavlvspvlEliYvwngfsrmskeeleeesvkkleeka... 451
                        a++ e++++lf++v+ l+q++agkslp+ekF++rK++r++          +   lv p+lE++Yvwngfs+++k+++++e+++ ++eka   
  SwissProt::Q8BYY4 421 ATK-ENVVSLFRQVDGLKQRIAGKSLPTEKFAVRKARRYSPPSG------VPGKLVMPALEMMYVWNGFSIVGKRKDLSENLLVTVEKAeea 505
                        777.*************************************866......99********************************99999887 PP

            DUF3808 452 .anke.seeeeDdellkkLLkglvlrrl 477
                         +n++ + +++Dde+l+kLLkg++l++l
  SwissProt::Q8BYY4 506 lQNQDfTDYSVDDECLVKLLKGCCLKNL 533
                        77777666999***************97 PP

  == domain 2  score: -1.9 bits;  conditional E-value: 0.057
            DUF3808 272 llfearieslkgnldeAlelleeii 296
                        l++ a ++  +g++d+A+++le++ 
  SwissProt::Q8BYY4 564 LFELAFLYKSQGEIDKAIKVLETAR 588
                        677788899999*******999764 PP



Or compare SwissProt::Q8BYY4 to CDD or PaperBLAST