PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS6579100 to PF10300 (DUF3808)

VIMSS6579100 has 563 amino acids

Query:       DUF3808  [M=477]
Accession:   PF10300.9
Description: Protein of unknown function (DUF3808)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
   7.1e-142  459.5   0.0   1.7e-141  458.2   0.0    1.5  2  VIMSS6579100  


Domain annotation for each sequence (and alignments):
>> VIMSS6579100  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  458.2   0.0  1.7e-141  1.7e-141       2     477 .]      17     474 ..      16     474 .. 0.96
   2 ?   -1.8   0.0     0.053     0.053     339     398 ..     496     558 ..     492     560 .. 0.69

  Alignments for each domain:
  == domain 1  score: 458.2 bits;  conditional E-value: 1.7e-141
       DUF3808   2 qaldlvLndkfeeaeellkeaskeSslhalgrgviafleAvltfepekmkkAsealkeaeklceksrkkaqkneskqnlssdslyepgleaevcyae 98 
                   q+l+ +L+dk++ea+e++k  s++Ss+h  g++v+af++Avltfep+++k+++++++ a k+ ++++++a+kn+     ++ s+++pg+e++v+++ 
  VIMSS6579100  17 QGLNDILDDKMDEATEKFK--SGNSSFHLSGQAVVAFIQAVLTFEPSRFKDSQNRIDIAIKALSADKDDASKNN-----TFLSTFDPGVEYRVSIGL 106
                   89****************8..99***************************************************.....5679************** PP

       DUF3808  99 alLlkAlLtflseslvefiKgglklRkaYqiykeilkeikklekkkrskteeeeesllseeknsqaeideflesGvnlgfGilqlviSllPpailkl 195
                   +lLl+Al++f+ses+v+++K+++klRka++i+++i+k++ ++ +++ ++   +++s       + + ++e++++G+ l++G+++l+iSllPp+++++
  VIMSS6579100 107 MLLLSALIGFCSESIVTSVKSVYKLRKAHSIFSKINKRHFDHFSAAFHS---TGRS-------DVDLANEYVQTGTLLCTGLFTLLISLLPPKMITI 193
                   ******************************************9888885...3333.......356899**************************** PP

       DUF3808 196 LsvvGFsGdreeGLrlLwe.ask.srnlraalallaLlfYytgvvqvldi....ddg.lkapleeleelLlksrkrfPksalwllfearieslkgnl 285
                   L+v+G++Gdr+++L+++w+ a +  +++ aa+a+ aL++Yy+g+vq+++i    +++  ++p++++ e+L+k++k++P++ +w l++a+++s+ +++
  VIMSS6579100 194 LNVFGYKGDRDWALQCMWMpALQrPTSFFAAVAFAALIQYYSGAVQLCSIykktPEEpDGWPDKRCFEILEKVEKAHPDGPMWPLHRAKLLSMVKKQ 290
                   *******************77776889***********************8764244678************************************* PP

       DUF3808 286 deAlelleeiieesqselkqvkhlclfelaltlvylheykeaaesfleLlklskwSkalYtYlaaacllelgreekkaeakekaeelfkevpkllqk 382
                   deA+ +lee++++   +lkq++ l++fe+al ++++h+y ++a+sfl+L++l++ S+alY+Y+aaac+l++++++++ ea eka++l++ +++l+++
  VIMSS6579100 291 DEAIVVLEELMAKPPPRLKQLEVLIVFEHALDCAFSHRYVDGANSFLKLSSLNDSSTALYSYFAAACFLQDVHVNANVEALEKASKLLEPLHDLVAN 387
                   ************************************************************************************************* PP

       DUF3808 383 kagkslplekFilrKverfkarkke..kkselldavlvspvlEliYvwngfsrmskeeleeesvkkleekaankeseeeeDdellkkLLkglvlrrl 477
                      k++pl+++i rKv ++ +r+++  +++ l+++v++sp++El+Yvwngf+rm+++el++ +v+++e +       +++Dd+++++L+k++vlr+l
  VIMSS6579100 388 ---KTAPLDVHIRRKVGKLIKRRASagNQGGLAEYVGFSPLYELVYVWNGFRRMTDDELSKFDVERMEPW-------QDQDDDICQALIKATVLRNL 474
                   ...*******************88889999*************************************999.......377***************97 PP

  == domain 2  score: -1.8 bits;  conditional E-value: 0.053
       DUF3808 339 kwSkalYtYlaaacllelgreekkaeakekaeelfkevpkllqkkag.....kslplekFilrKv 398
                   +w  a+ +Y  a+ + e   +  k+e+ ++  ++++++ ++ ++ ++       ++l ++++rK+
  VIMSS6579100 496 TWAVAFAHYEMAVAFFESNGS--KKEGLKHCDAYLRKARDFGGDNEFesrliIRVQLARHVVRKC 558
                   577777777777766665555..667778888888888888888888754444567777777776 PP



Or compare VIMSS6579100 to CDD or PaperBLAST