PaperBLAST – Find papers about a protein or its homologs

 

Align XP_001700100.1 to PF10300 (DUF3808)

XP_001700100.1 has 782 amino acids

Query:       DUF3808  [M=477]
Accession:   PF10300.9
Description: Protein of unknown function (DUF3808)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
      1e-09   23.6   0.1    4.2e-09   21.6   0.0    2.0  1  XP_001700100.1  


Domain annotation for each sequence (and alignments):
>> XP_001700100.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   21.6   0.0   4.2e-09   4.2e-09     262     358 ..     214     310 ..     191     376 .. 0.88

  Alignments for each domain:
  == domain 1  score: 21.6 bits;  conditional E-value: 4.2e-09
         DUF3808 262 rkrfPksalwllfearieslkgnldeAlelleeiieesqselkqvkhlclfelaltlvylheykeaaesfleLlklskwSkalYtYlaaacllel 356
                     +k fP+s ++ ++ + i + +++  +A++++ +++++ +   k+v+  ++ +++l +v + +y +a++sf  ++++    ++ Y+ + + + l++
  XP_001700100.1 214 NKNFPQSGWLRVNMGNIHFEQKKYPSAIKMYRMALDQISATAKEVRFKIMRNIGLSFVRMGQYPDALQSFATVMDNVPDHQTGYNLVMCNYALSD 308
                     467***********************************************************************998888888887777776666 PP

         DUF3808 357 gr 358
                      +
  XP_001700100.1 309 RE 310
                     55 PP



Or compare XP_001700100.1 to CDD or PaperBLAST