PaperBLAST – Find papers about a protein or its homologs

 

Align XP_006538304.1 to PF10300 (DUF3808)

XP_006538304.1 has 427 amino acids

Query:       DUF3808  [M=477]
Accession:   PF10300.9
Description: Protein of unknown function (DUF3808)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
   3.8e-116  374.6   2.0   1.2e-115  373.0   2.0    1.7  2  XP_006538304.1  


Domain annotation for each sequence (and alignments):
>> XP_006538304.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  373.0   2.0  1.2e-115  1.2e-115     158     477 .]      31     343 ..       9     343 .. 0.95
   2 ?   -1.1   0.0     0.034     0.034     272     296 ..     374     398 ..     367     406 .. 0.80

  Alignments for each domain:
  == domain 1  score: 373.0 bits;  conditional E-value: 1.2e-115
         DUF3808 158 eeknsqaeideflesGvnlgfGilqlviSllPpailklLsvvGFsGdreeGLrlLweasksrnlraalallaLlfYytgvvqvldiddglkaple 252
                     ++k ++++    +e+Gv+lg+G+++l++SllP++i++lL+++GFsG+r+ GL +L+e+++  ++r++l++l++l+++t+++ +l++   ++++  
  XP_006538304.1  31 KNK-QEQHFFYEFEGGVKLGTGAFNLMLSLLPARIIRLLEFIGFSGNRDLGLLQLREGASGSSMRSPLCCLTILAFHTYISLILGT---GEVNVV 121
                     223.35678889**************************************************************************...89**** PP

         DUF3808 253 eleelLlksrkrfPksalwllfearieslkgnldeAlelleeiieesqselkqvkhlclfelaltlvylheykeaaesfleLlklskwSkalYtY 347
                     e+e+lL++++++fP+++l+l+++arie lkgn ++A+e++ ++i + q+e+kq++hlc++el+++++y++++ +a+ + ++L+k+skwSka+Y++
  XP_006538304.1 122 EAESLLAPFLQQFPNGSLILFYHARIELLKGNTEKAQETFRKCI-SVQEEWKQFHHLCYWELMWIHIYQQNWMQAYYYSDLLCKESKWSKATYVF 215
                     ********************************************.9************************************************* PP

         DUF3808 348 laaacllelgreekkaeakekaeelfkevpkllqkkagkslplekFilrKverfkarkkekkselldavlvspvlEliYvwngfsrmskeeleee 442
                     l+aa+l++l++ee +a++ e++++lf++v+ l+q++agkslp+ekF++rK++r++          +   lv p+lE++Yvwngfs+++k+++++e
  XP_006538304.1 216 LKAAILSMLPEEEVAATK-ENVVSLFRQVDGLKQRIAGKSLPTEKFAVRKARRYSPPSG------VPGKLVMPALEMMYVWNGFSIVGKRKDLSE 303
                     ************888777.*************************************866......99**************************** PP

         DUF3808 443 svkkleeka....anke.seeeeDdellkkLLkglvlrrl 477
                     +++ ++eka    +n++ + +++Dde+l+kLLkg++l++l
  XP_006538304.1 304 NLLVTVEKAeealQNQDfTDYSVDDECLVKLLKGCCLKNL 343
                     ****9999988777777666999***************97 PP

  == domain 2  score: -1.1 bits;  conditional E-value: 0.034
         DUF3808 272 llfearieslkgnldeAlelleeii 296
                     l++ a ++  +g++d+A+++le++ 
  XP_006538304.1 374 LFELAFLYKSQGEIDKAIKVLETAR 398
                     6777888899999999999999764 PP



Or compare XP_006538304.1 to CDD or PaperBLAST