PaperBLAST – Find papers about a protein or its homologs

 

Align NP_651555.1 to PF10350 (DUF2428)

NP_651555.1 has 1120 amino acids

Query:       DUF2428  [M=275]
Accession:   PF10350.9
Description: Putative death-receptor fusion protein (DUF2428)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    4.6e-44  136.8   3.7    9.8e-44  135.7   3.7    1.6  1  NP_651555.1  


Domain annotation for each sequence (and alignments):
>> NP_651555.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  135.7   3.7   9.8e-44   9.8e-44       3     274 ..     638     898 ..     636     899 .. 0.82

  Alignments for each domain:
  == domain 1  score: 135.7 bits;  conditional E-value: 9.8e-44
      DUF2428   3 verllelcerisevvlpvvs....ssspegllpedldseeesaeeeeeeeeeeeeekkekeekkkvtaqvvlvccWrsmKevslllgtllqklplqte 96 
                  +e+ll l+eri++ +l++++      + e  + +++++++es    +   +e++ + +++ee++    +++l+ +W+++K ++ l +++    +lqt+
  NP_651555.1 638 LEDLLPLLERILSGILKFLNvanaRRQEEAATAASFQDMDES---LQLLVSESSFKCDGEEEAC---RKYLLMSFWLTLKGCCDLATSIG-CYQLQTS 728
                  689****************96553333333566666655554...2224445555544554444...49********************9.3444444 PP

      DUF2428  97 kessdssglltveqleeigelfleqLlelrHrGAfekayvgFtklcerllrskdee..lqk.lpeqwleelleeikssssklcitRRSAGlPfliqal 191
                  ++       +++e+l+++ ++ +++L+ +rH+GA+e+a  ++++l++++ +s d+     + l++++ +ell e    s++ ++tRR+AG++++++++
  NP_651555.1 729 AK------TVNTETLRRCLNINVSVLTLCRHKGAIEAAGLSIGRLTRAITSSLDSCdsGFQmLHDCLERELLTE----SRQVSTTRRGAGFAIMFLHV 816
                  33......578899**************************************9954445554777777788877....779999************** PP

      DUF2428 192 lssepkkskkklLkrtmkeLlelakkeaseeesesddesdlpqvhalNiLralfrdsrLgeevspyvadglilaiegfsspvW 274
                  l++++ + ++ lL+r+++++l+  ++++++e+   d+++d+++   l++L++l+rd++L+ ++s+y++++l +a+e++++p+W
  NP_651555.1 817 LKNDNPR-QRLLLHRAVQQILKRLNENQTAETVCLDSNHDRWEALVLHYLCVLVRDTELRPAMSKYYNEILLVAMEHITNPEW 898
                  ***9998.7889*************7554444444599********************************************* PP



Or compare NP_651555.1 to CDD or PaperBLAST