PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10097873 to PF10350 (DUF2428)

VIMSS10097873 has 2149 amino acids

Query:       DUF2428  [M=275]
Accession:   PF10350.9
Description: Putative death-receptor fusion protein (DUF2428)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    5.6e-90  287.4   0.1    1.1e-89  286.4   0.1    1.6  1  VIMSS10097873  


Domain annotation for each sequence (and alignments):
>> VIMSS10097873  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  286.4   0.1   1.1e-89   1.1e-89       3     275 .]     961    1280 ..     959    1280 .. 0.94

  Alignments for each domain:
  == domain 1  score: 286.4 bits;  conditional E-value: 1.1e-89
        DUF2428    3 verllelcerisevvlpvvsssspegllpedldseeesa......eeeee....eeeeeeeekkekeekk.kvtaqvvlvccWrsmKevslllg 85  
                     +e+ll+l+ ri++++l+vvs+++    lped+d+  +++      +   +    + +ee++++  k++++   ++qvv+v+cW++mKevslllg
  VIMSS10097873  961 LEKLLKLVTRITTLALWVVSADALC--LPEDMDDIIDDDsffsnvQ---DdsaaVLSEEHTSTYPKHVHEtVQSEQVVMVGCWLAMKEVSLLLG 1049
                     699*******************998..9******999987766542...14557778888888899999999999******************* PP

        DUF2428   86 tllqklplqtekessdss.................glltveqleeigelfleqLlelrHrGAfekayvgFtklcerllrskdeelqklpeqwle 162 
                     t+++k+pl+t++ +  ++                 +ll+++qle+ig++fle+Ll+++H+GA++k+++gFt+lc+rll+s+d++l+kl+e+w+e
  VIMSS10097873 1050 TIIRKIPLPTSSLRPLENgdtassvpndlvignseSLLDLKQLEKIGDHFLEVLLKMKHNGAIDKTRAGFTALCHRLLCSNDPRLCKLTESWME 1143
                     **********998877779999************************************************************************ PP

        DUF2428  163 elleeikss.ssklcitRRSAGlPfliqallssepkkskkklLkrtmkeLlelakkea.......................seeesesddesdl 232 
                     +l+e++ ++ +++++++RRSAG+P++++al++sep++s+kklL+r++++L+ la+k++                       +e+ s+ +de ++
  VIMSS10097873 1144 QLMERTVAKgQTVDDVLRRSAGIPAAFIALFLSEPEGSPKKLLPRALRWLIGLAEKPLmepleqkgskhmveeinssdmhsNEKLSKVRDEGVV 1237
                     *******99***********************************************99****************999998877778888***** PP

        DUF2428  233 pqvhalNiLralfrdsrLgeevspyvadglilaiegfsspvWa 275 
                     p+vha+N+L+a f+d++L++++s + a+++i++i++fssp+W+
  VIMSS10097873 1238 PTVHAFNVLKATFNDTNLSTDTSGFSAEAMIVSIRSFSSPYWE 1280
                     ******************************************5 PP



Or compare VIMSS10097873 to CDD or PaperBLAST