PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS6578387 to PF10350 (DUF2428)

VIMSS6578387 has 1502 amino acids

Query:       DUF2428  [M=275]
Accession:   PF10350.9
Description: Putative death-receptor fusion protein (DUF2428)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    3.7e-67  212.5   0.0    8.6e-67  211.3   0.0    1.6  2  VIMSS6578387  


Domain annotation for each sequence (and alignments):
>> VIMSS6578387  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -3.7   0.0      0.31      0.31     241     264 ..      79     102 ..      78     103 .. 0.92
   2 !  211.3   0.0   8.6e-67   8.6e-67       2     274 ..     625     867 ..     624     868 .. 0.91

  Alignments for each domain:
  == domain 1  score: -3.7 bits;  conditional E-value: 0.31
       DUF2428 241 LralfrdsrLgeevspyvadglil 264
                   Lr +f+  +   e+s+yv d+++l
  VIMSS6578387  79 LRRIFNACKQDPEISKYVWDTMEL 102
                   99****************999986 PP

  == domain 2  score: 211.3 bits;  conditional E-value: 8.6e-67
       DUF2428   2 lverllelcerisevvlpvvsssspegllpedldseeesaeeeeeeeeeeeeekkekeekkkvtaqvvlvccWrsmKevslllgtllqklplqteke 98 
                   +v +l++ +e i+ ++++v++++speg+lp+ + +              ++ e        ++ aq++l+++Wrs+Ke s ll+ ll+k     ++e
  VIMSS6578387 625 IVMELIKASETIWGLIKDVLCDDSPEGNLPDGEGEGGI----------VSNLE--------DTPAQLILSYSWRSLKETSSLLTVLLTKCLSLFDEE 703
                   6889**************************99875221..........12222........3567**********************8888777654 PP

       DUF2428  99 ssdssglltveqleeigelfleqLlelrHrGAfekayvgFtklcerllrskdeelqklpeqwleelleeikssssklcitRRSAGlPfliqallsse 195
                          +t  +l+  gel++++L e+rHrGAf+++y++F ++c+ l++++++e+++lp+ wl++ l+ i+  ++++ itRRS G+P+ i+a+l + 
  VIMSS6578387 704 -------FTPFTLNYYGELMMTWLWEIRHRGAFTSVYPCFIEYCSFLFECNKHEISELPDPWLHKNLSVIQ--EKSSFITRRSGGIPLSITAILVAG 791
                   .......5566799*********************************************************..***********************9 PP

       DUF2428 196 pkkskkklLkrtmkeLlelakkeaseeesesddesdlpqvhalNiLralfrdsrLgeevspyvadglilaiegfsspvW 274
                   ++k  ++l+++t+ +L+++ak++++++  +   + dlpqvha+N+L+++f+++rL++ + +y+++++ l+iegfs++ W
  VIMSS6578387 792 KDK-REQLIEQTVISLISIAKQPVEQK--NIAGQFDLPQVHAMNTLKTIFTEHRLSSVSVEYLEPAIALSIEGFSHELW 867
                   999.678**************997666..5567899******************************************* PP



Or compare VIMSS6578387 to CDD or PaperBLAST