NP_001320702.1 has 127 amino acids
Query: BMT5-like [M=168] Accession: PF10354.13 Description: rRNA (uridine-N3-)-methyltransferase BTM5-like Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.6e-37 113.5 0.0 7.6e-37 113.3 0.0 1.1 1 NP_001320702.1 Domain annotation for each sequence (and alignments): >> NP_001320702.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 113.3 0.0 7.6e-37 7.6e-37 1 96 [. 29 122 .. 29 127 .] 0.96 Alignments for each domain: == domain 1 score: 113.3 bits; conditional E-value: 7.6e-37 BMT5-like 1 LlvGeGdfSFslslakalgsaeeealvatsldseeeleekypeaeenleeLeeegvkvlfgvDatklekeeklkkkkfdriiFnFPhvGgkskdv 95 LlvGeGdfSFs+sla+ +gsa++ + a+slds++++ +ky++a++nle+L+++g+ +l+gvDat+l+ +++l+ ++fdr+iFnFPh+G++ k+ NP_001320702.1 29 LLVGEGDFSFSCSLATCFGSASN--IYASSLDSYDDVVRKYKNARSNLETLKRLGAFLLHGVDATTLHFHPDLRYRRFDRVIFNFPHTGFHRKES 121 8********************99..******************************************************************9876 PP BMT5-like 96 e 96 + NP_001320702.1 122 D 122 6 PP
Or compare NP_001320702.1 to CDD or PaperBLAST