PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10092444 to PF10615 (DUF2470)

VIMSS10092444 has 321 amino acids

Query:       DUF2470  [M=77]
Accession:   PF10615.9
Description: Protein of unknown function (DUF2470)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    5.5e-18   51.7   0.1    1.1e-17   50.7   0.1    1.6  1  VIMSS10092444  


Domain annotation for each sequence (and alignments):
>> VIMSS10092444  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   50.7   0.1   1.1e-17   1.1e-17       3      77 .]     242     314 ..     240     314 .. 0.91

  Alignments for each domain:
  == domain 1  score: 50.7 bits;  conditional E-value: 1.1e-17
                    HHHHHHHHH-HHHHHHHHHHCST-TTCCEEEEEEE-SSEEEEEEC.....CEEEEEE-SS---SCCHHHHHHHHH CS
        DUF2470   3 riiaHMNkDHaddlllylrhygkvkeaksarmtdidldgltlrlgakagsektvripFdpplkswaearerLveM 77 
                     +++HMNkDH++d ++++    +++  +sa m+d+d+ g+++++ + +g++ ++r+pF+++ +++++++  +veM
  VIMSS10092444 242 PVTSHMNKDHEEDTKAIVHNITSIPV-ESALMLDLDSLGFNVKA-TLQGNTFKLRVPFPRRAQDRKDVKTLIVEM 314
                    5789*****************87777.7999************5.466569***********************9 PP



Or compare VIMSS10092444 to CDD or PaperBLAST