NP_218297.1 has 178 amino acids
Query: BPA [M=160] Accession: PF10759.13 Description: Bacterial proteasome activator Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-83 263.6 1.8 3e-83 263.3 1.8 1.0 1 NP_218297.1 Domain annotation for each sequence (and alignments): >> NP_218297.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 263.3 1.8 3e-83 3e-83 6 144 .. 32 171 .. 28 178 .] 0.93 Alignments for each domain: == domain 1 score: 263.3 bits; conditional E-value: 3e-83 BPA 6 deeeeeeeevadlveqPakvmrigtmikqlleevraapldeasrkrlkeihersikeleeglaPelveelerlslpftedatPsdaelriaqaqlvGW 103 +e++++e++++dlveqPakvmrigtmikqlleevraapldeasr+rl++ih++si+ele+glaPel+eel+rl+lpf+eda+PsdaelriaqaqlvGW NP_218297.1 32 QENDSDESSLTDLVEQPAKVMRIGTMIKQLLEEVRAAPLDEASRNRLRDIHATSIRELEDGLAPELREELDRLTLPFNEDAVPSDAELRIAQAQLVGW 129 67888999****************************************************************************************** PP BPA 104 leGlfhGiqtalvaqqmaaraqleqlrr.alPpggeaaeeeg 144 leGlfhGiqtal+aqqmaaraql+q+r+ alPpg ++ ++g NP_218297.1 130 LEGLFHGIQTALFAQQMAARAQLQQMRQgALPPGVGKSGQHG 171 ****************************99****55544444 PP
Or compare NP_218297.1 to CDD or PaperBLAST