PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001131962.1 to PF10914 (DUF2781)

NP_001131962.1 has 117 amino acids

Query:       DUF2781  [M=147]
Accession:   PF10914.8
Description: Protein of unknown function (DUF2781)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    2.4e-27   82.3   0.9    2.8e-27   82.1   0.9    1.0  1  NP_001131962.1  


Domain annotation for each sequence (and alignments):
>> NP_001131962.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   82.1   0.9   2.8e-27   2.8e-27       1     102 [.       9     109 ..       9     114 .. 0.96

  Alignments for each domain:
  == domain 1  score: 82.1 bits;  conditional E-value: 2.8e-27
         DUF2781   1 DlvyllyflihipitllvDlqvllpaslfphflsklrewyiatnnDpllleppaWfksfvllelffqlPlffiavyaLlkkekpwlrllllvYgv 95 
                     D++++++ l+ ++++ l+D+q +lp +l+p++l +l++wy a+++D+l++++p +f+ +v+lel fq+Pl ++ +y++l + ++w  +++l+ gv
  NP_001131962.1   9 DAIVAVFSLTIVVAAPLLDAQSVLPHTLYPAPLLELKRWYAAEFGDYLVAQSPGFFRGLVCLELAFQWPLAVATLYGIL-TRRRWAATTSLMAGV 102
                     78999**************************************************************************.579************ PP

         DUF2781  96 haatttl 102
                      ++t+++
  NP_001131962.1 103 GTLTSMV 109
                     ****987 PP



Or compare NP_001131962.1 to CDD or PaperBLAST