PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10090284 to PF10914 (DUF2781)

VIMSS10090284 has 168 amino acids

Query:       DUF2781  [M=147]
Accession:   PF10914.8
Description: Protein of unknown function (DUF2781)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    6.8e-38  116.6   1.8    7.7e-38  116.4   1.8    1.0  1  VIMSS10090284  


Domain annotation for each sequence (and alignments):
>> VIMSS10090284  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  116.4   1.8   7.7e-38   7.7e-38       1     145 [.       9     144 ..       9     146 .. 0.96

  Alignments for each domain:
  == domain 1  score: 116.4 bits;  conditional E-value: 7.7e-38
        DUF2781   1 DlvyllyflihipitllvDlqvllpaslfphflsklrewyiatnnDpllleppaWfksfvllelffqlPlffiavyaLlkkekpwlrllllvYgvh 96 
                    D+v++lyf+++++i+ l+D q  lp+++fp+f+ +l++wyi++++D+l++e+p+++  +v+ el++ +Pl++++vya+l  +k+w+ ++++vYg++
  VIMSS10090284   9 DAVLFLYFALMAVIAPLIDGQTSLPGDIFPAFIVDLNRWYIDEFGDYLVKEKPHFLVGLVWHELLLLWPLSIVNVYAIL-AGKSWFGTTSMVYGAS 103
                    899****************************************************************************.59************** PP

        DUF2781  97 aatttlaciaellsegeavasesekqklkllalylpylliPlllavdml 145
                    ++t+++a+++e++ +         k+  kll++y+p++ +++l +++ l
  VIMSS10090284 104 VVTSMAAILGEMIGS--------GKASEKLLMMYVPFMGVGILALLRGL 144
                    ************995........556678***************99976 PP



Or compare VIMSS10090284 to CDD or PaperBLAST