VIMSS220478 has 143 amino acids
Query: DUF2946 [M=118] Accession: PF11162.12 Description: Protein of unknown function (DUF2946) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6e-30 90.6 16.0 7.1e-30 90.4 16.0 1.1 1 VIMSS220478 Domain annotation for each sequence (and alignments): >> VIMSS220478 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 90.4 16.0 7.1e-30 7.1e-30 2 118 .] 23 138 .. 22 138 .. 0.99 Alignments for each domain: == domain 1 score: 90.4 bits; conditional E-value: 7.1e-30 DUF2946 2 wlallavllavlaPlvsqaaaaaaaasllageiCssagsaaaaaaaagdagddsaasaadsehCgyCsllaagpalppaalapllpaaaaaaapalal 99 wl l+a+++++++Pl+sq+++++++a++ + + +++a++ ++++++a+++++++++ + ++e+CgyCsll+++palp+a++++ + a++++ ++++ VIMSS220478 23 WLSLFAMWMIFIGPLISQSMPMDHHAGMNMPMDMPMAAA-HQHGGDAHHGHGGDGQLHVMWEKCGYCSLLFNCPALPQALSPLSAGSIAPTTHLLAPT 119 ***************************************.********************************************************** PP DUF2946 100 aaapalpallpaarpRAPP 118 +++a++a++p+ar+RAPP VIMSS220478 120 HQGHARQAVFPGARSRAPP 138 ******************9 PP
Or compare VIMSS220478 to CDD or PaperBLAST