PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001320709.1 to PF11523 (DUF3223)

NP_001320709.1 has 1439 amino acids

Query:       DUF3223  [M=75]
Accession:   PF11523.8
Description: Protein of unknown function (DUF3223)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    2.3e-26   78.8   0.2    8.1e-26   77.1   0.1    2.1  2  NP_001320709.1  


Domain annotation for each sequence (and alignments):
>> NP_001320709.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -3.7   0.0         1         1      43      65 ..     714     733 ..     667     734 .. 0.70
   2 !   77.1   0.1   8.1e-26   8.1e-26       1      75 []    1333    1405 ..    1333    1405 .. 0.95

  Alignments for each domain:
  == domain 1  score: -3.7 bits;  conditional E-value: 1
                     EEE.EESSS.S-EEEEEEETTS- CS
         DUF3223  43 ikvglhpefedsrCFfvvrkDgs 65 
                     +  ++   + +s +F +++k gs
  NP_001320709.1 714 LAYRY---GDQSNSFLIMSKAGS 733
                     34444...345888888887776 PP

  == domain 2  score: 77.1 bits;  conditional E-value: 8.1e-26
                      HHHHHHS-TTEE--HHHHHHHHH.HHHTSTTHHHHHTT-EEEEEE.EESSS.S-EEEEEEETTS-EEE--GGGSS CS
         DUF3223    1 keiLhkydvgeelsdedeailleellkyhpeaekkigagvdsikvglhpefedsrCFfvvrkDgsaeDFSyrkCv 75  
                      k+iLh+y+ +e l+++de ++ + +l+ hp++ +kig gv++i+v++ ++++ds CF vvr Dg+ eDFSy+kCv
  NP_001320709.1 1333 KRILHSYEINELLNERDEGLVKM-VLQLHPNSVEKIGPGVKGIRVAK-SKHGDSCCFEVVRIDGTFEDFSYHKCV 1405
                      78****************96665.**********************9.7889**********************8 PP



Or compare NP_001320709.1 to CDD or PaperBLAST