PaperBLAST – Find papers about a protein or its homologs

 

Align NP_201050.2 to PF11523 (DUF3223)

NP_201050.2 has 202 amino acids

Query:       DUF3223  [M=75]
Accession:   PF11523.8
Description: Protein of unknown function (DUF3223)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    9.8e-29   86.4   0.6    1.6e-28   85.7   0.1    1.6  2  NP_201050.2  


Domain annotation for each sequence (and alignments):
>> NP_201050.2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -2.2   0.0      0.45      0.45      34      34 ..      47      47 ..      14      70 .. 0.57
   2 !   85.7   0.1   1.6e-28   1.6e-28       2      75 .]      86     158 ..      85     158 .. 0.98

  Alignments for each domain:
  == domain 1  score: -2.2 bits;  conditional E-value: 0.45
                 H CS
      DUF3223 34 k 34
                 +
  NP_201050.2 47 E 47
                 2 PP

  == domain 2  score: 85.7 bits;  conditional E-value: 1.6e-28
                  HHHHHS-TTEE--HHHHHHHHH.HHHTSTTHHHHHTT-EEEEEE.EESSS.S-EEEEEEETTS-EEE--GGGSS CS
      DUF3223   2 eiLhkydvgeelsdedeailleellkyhpeaekkigagvdsikvglhpefedsrCFfvvrkDgsaeDFSyrkCv 75 
                  ++Lh ++ + +++++++++ll+ + k+h e ekkig g+++++v+ hp  ++srCFf+vr+D++a+DFS+rkCv
  NP_201050.2  86 KFLHFWPTDLDVNKYEHMVLLDLIKKGHSEPEKKIGGGIKTFQVRTHPM-WKSRCFFLVREDDTADDFSFRKCV 158
                  58*********************************************97.9**********************8 PP



Or compare NP_201050.2 to CDD or PaperBLAST